MEGF8 Antibody

Images

 
Immunohistochemistry-Paraffin: MEGF8 Antibody [NBP2-14228] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells and processes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MEGF8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PCSPMPRSPEECRRLRTCSECLARHPRTLQPGDGEASTPRCKWCTNCPEG ACIGRNGSCTSENDCRINQREVFWAGNCSEAACGAADCEQCTREGKCMWT RQFKRTGETRRILSVQPTYDWTCFSHSLLNVS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MEGF8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MEGF8 Protein (NBP2-14228PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MEGF8 Antibody

  • C19orf49
  • chromosome 19 open reading frame 49
  • EGFL4MGC120684
  • EGF-like domain-containing protein 4
  • EGF-like protein 4
  • EGF-like-domain, multiple 4
  • Epidermal growth factor-like protein 4
  • FLJ22365
  • HBV pre-s2 binding protein 1
  • KIAA0817
  • MGC138147
  • multiple EGF-like domain protein 4
  • Multiple EGF-like domains protein 8
  • multiple EGF-like-domains 8
  • multiple epidermal growth factor-like domains 8
  • multiple epidermal growth factor-like domains protein 8
  • SBP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54805
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-53795
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF4779
Species: Hu
Applications: WB, IHC
NB100-79814
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
AF3798
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-86745
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-368
Species: Hu
Applications: WB
NBP1-91780
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57242
Species: Hu
Applications: WB, ICC/IF
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
NBP1-89817
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-88263
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14228
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for MEGF8 Antibody (NBP2-14228) (0)

There are no publications for MEGF8 Antibody (NBP2-14228).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEGF8 Antibody (NBP2-14228) (0)

There are no reviews for MEGF8 Antibody (NBP2-14228). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MEGF8 Antibody (NBP2-14228) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MEGF8 Products

Bioinformatics Tool for MEGF8 Antibody (NBP2-14228)

Discover related pathways, diseases and genes to MEGF8 Antibody (NBP2-14228). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEGF8 Antibody (NBP2-14228)

Discover more about diseases related to MEGF8 Antibody (NBP2-14228).
 

Pathways for MEGF8 Antibody (NBP2-14228)

View related products by pathway.

Blogs on MEGF8

There are no specific blogs for MEGF8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MEGF8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MEGF8