Vitamin D BP Antibody

Images

 
Independent Antibodies: Western Blot: Vitamin D BP Antibody [NBP1-88027] - Analysis using Anti-GC antibody NBP1-88027 (A) shows similar pattern to independent antibody NBP1-88028 (B).
Western Blot: Vitamin D BP Antibody [NBP1-88027] - Equine adult and embryonic liver cell lysates. WB image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Vitamin D BP Antibody [NBP1-88027] - Staining of human liver shows cytoplasmic positivity in hepatocytes.
Western Blot: Vitamin D BP Antibody [NBP1-88027] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, Rt, EqSpecies Glossary
Applications WB, Simple Western, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

Vitamin D BP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Simple Western
  • Western Blot 0.04 - 0.4 ug/mL
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Vitamin D BP antibody validated for Simple Western from a verified customer review.
Control Peptide
Vitamin D BP Protein (NBP1-88027PEP)
Reviewed Applications
Read 2 Reviews rated 5
using
NBP1-88027 in the following applications:

Reactivity Notes

Equine reactivity reported from a verified by customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Vitamin D BP Antibody

  • DBP
  • DBP/GC
  • DBP-MAF
  • DBPVDBG
  • EC 6.3.1.5
  • Gc
  • gc-globulin
  • Gc-MAF
  • GRD3
  • group-specific component (vitamin D binding protein)
  • Group-specific component
  • hDBP
  • VDB
  • VDBG
  • VDBP
  • Vitamin D BP
  • vitamin D-binding alpha-globulin
  • vitamin D-binding protein

Background

Vitamin D Binding Protein is a secreted multifunctional protein found in plasma, ascitic fluid, cerebrospinal fluid and urine, and on the surface of many cell types. In plasma, it carries the vitamin D sterols and prevents polymerization of actin by binding its monomers. DBP associates with membrane bound immunoglobulin on the surface of B lymphocytes and with IgG fc receptor on the membranes of T lymphocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Vitamin D BP Antibody (NBP1-88027) (0)

There are no publications for Vitamin D BP Antibody (NBP1-88027).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Vitamin D BP Antibody (NBP1-88027) (2) 52

Average Rating: 5
(Based on 2 reviews)
We have 2 reviews tested in 2 species: Rat, Equine.

Reviews using NBP1-88027:
Filter by Applications
WB
(1)
Simple Western
(1)
All Applications
Filter by Species
Rat
(1)
Equine
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Vitamin D BP NBP1-88027
Enlarge
5
reviewed by:
Shavahn Loux
WB Equine 02/02/2020
View

Summary

ApplicationWestern Blot
Sample TestedEmbryonic liver,Liver
SpeciesEquine
LotA114401

Comments

Comments!:3000 dilution
  5
reviewed by:
Verified Customer
Simple Western Rat 05/25/2017
View

Summary

ApplicationSimple Western
Sample TestedSerum
SpeciesRat

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Vitamin D BP Antibody (NBP1-88027). (Showing 1 - 1 of 1 FAQ).

  1. Does vitamin d binding protein have both nuclear and cytoplasmic staining?
    • From the image on our website, NBP1-88027 shows cytoplasmic staining. Furthermore, as Vitamin D binding protein is secreted, nuclear staining would not be expected.

Secondary Antibodies

 

Isotype Controls

Additional Vitamin D BP Products

Research Areas for Vitamin D BP Antibody (NBP1-88027)

Find related products by research area.

Blogs on Vitamin D BP

There are no specific blogs for Vitamin D BP, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
2
4
0
3
0
2
0
1
0

Shavahn Loux
02/02/2020
Application: WB
Species: Equine

 
Verified Customer
05/25/2017
Application: Simple Western
Species: Rat

Bioinformatics

Gene Symbol GC