Vitamin D BP Antibody

Images

 
Western Blot: Vitamin D BP Antibody [NBP1-88027] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Vitamin D BP Antibody [NBP1-88027] - Staining of human liver shows cytoplasmic positivity in hepatocytes.
Western Blot: Vitamin D BP Antibody [NBP1-88027] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Vitamin D BP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Vitamin D BP Protein (NBP1-88027PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-88027 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Vitamin D BP Antibody

  • DBP
  • DBP/GC
  • DBP-MAF
  • DBPVDBG
  • EC 6.3.1.5
  • Gc
  • gc-globulin
  • Gc-MAF
  • GRD3
  • group-specific component (vitamin D binding protein)
  • Group-specific component
  • hDBP
  • VDB
  • VDBG
  • VDBP
  • Vitamin D BP
  • vitamin D-binding alpha-globulin
  • vitamin D-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-22568
Species: Hu
Applications: IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
AF7895
Species: Hu
Applications: WB, IHC
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45825
Species: Hu
Applications: WB, IHC
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-35213
Species: Hu
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Vitamin D BP Antibody (NBP1-88027) (0)

There are no publications for Vitamin D BP Antibody (NBP1-88027).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Vitamin D BP Antibody (NBP1-88027) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Rat.
We have 1 review tested in 1 application: Simple Western.

Reviews using NBP1-88027:
Filter by Applications
Simple Western
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
Anonymous
Simple Western Rat 05/25/2017
View

Summary

ApplicationSimple Western
Sample TestedSerum
SpeciesRat

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Vitamin D BP Antibody (NBP1-88027). (Showing 1 - 1 of 1 FAQ).

  1. Does vitamin d binding protein have both nuclear and cytoplasmic staining?
    • From the image on our website, NBP1-88027 shows cytoplasmic staining. Furthermore, as Vitamin D binding protein is secreted, nuclear staining would not be expected.

Secondary Antibodies

 

Isotype Controls

Additional Vitamin D BP Products

Bioinformatics Tool for Vitamin D BP Antibody (NBP1-88027)

Discover related pathways, diseases and genes to Vitamin D BP Antibody (NBP1-88027). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Vitamin D BP Antibody (NBP1-88027)

Discover more about diseases related to Vitamin D BP Antibody (NBP1-88027).
 

Pathways for Vitamin D BP Antibody (NBP1-88027)

View related products by pathway.

PTMs for Vitamin D BP Antibody (NBP1-88027)

Learn more about PTMs related to Vitamin D BP Antibody (NBP1-88027).

Blogs on Vitamin D BP

There are no specific blogs for Vitamin D BP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

 
Anonymous
05/25/2017
Application: Simple Western
Species: Rat

Bioinformatics

Gene Symbol GC
Entrez