VTA1 Antibody

Images

 
Western Blot: VTA1 Antibody [NBP1-86745] - Analysis using Anti-VTA1 antibody NBP1-86745 (A) shows similar pattern to independent antibody NBP2-58305 (B).
Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.
Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745] - Staining of human cerebral cortex shows weak positivity in neurons.
Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745] - Staining of human skeletal muscle shows negative to very weak cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VTA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEA
Specificity
Specificity of human, mouse, rat VTA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VTA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
VTA1 Protein (NBP1-86745PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VTA1 Antibody

  • C6orf55DRG1
  • Dopamine-responsive gene 1 protein
  • DRG-1
  • FLJ27228
  • homolog of mouse SKD1-binding protein 1
  • LIP5HSPC228
  • LYST-interacting protein 5
  • My012
  • SBP1chromosome 6 open reading frame 55
  • SKD1-binding protein 1
  • vacuolar protein sorting-associated protein VTA1 homolog
  • Vps20-associated 1 homolog (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54618
Species: Hu
Applications: WB, IHC
NBP1-54805
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-46283
Species: Hu
Applications: WB, IHC
NBP1-91780
Species: Hu
Applications: IHC, IHC-P
NB100-53795
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PEP-ELISA, KD
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NBP3-06005
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-20881
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP2-87183
Species: Hu, Mu
Applications: WB, IHC-P
H00011329-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00005119-B02P
Species: Hu
Applications: WB, ICC/IF
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-97572
Species: Hu, Mu, Rt, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, In vivo, KD
NBP2-33720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89461
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF3928
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO

Publications for VTA1 Antibody (NBP1-86745) (0)

There are no publications for VTA1 Antibody (NBP1-86745).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VTA1 Antibody (NBP1-86745) (0)

There are no reviews for VTA1 Antibody (NBP1-86745). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VTA1 Antibody (NBP1-86745) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional VTA1 Products

Bioinformatics Tool for VTA1 Antibody (NBP1-86745)

Discover related pathways, diseases and genes to VTA1 Antibody (NBP1-86745). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VTA1 Antibody (NBP1-86745)

Discover more about diseases related to VTA1 Antibody (NBP1-86745).
 

Pathways for VTA1 Antibody (NBP1-86745)

View related products by pathway.

PTMs for VTA1 Antibody (NBP1-86745)

Learn more about PTMs related to VTA1 Antibody (NBP1-86745).

Blogs on VTA1

There are no specific blogs for VTA1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VTA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VTA1