RPSA Antibody (2Q8Q6)

Western Blot: RPSA Antibody (2Q8Q6) [NBP3-16624] - Western blot analysis of extracts of various cell lines, using RPSA Rabbit mAb (NBP3-16624) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunocytochemistry/Immunofluorescence: RPSA Antibody (2Q8Q6) [NBP3-16624] - Immunofluorescence analysis of NIH-3T3 cells using RPSA Rabbit mAb (NBP3-16624) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: RPSA Antibody (2Q8Q6) [NBP3-16624] - Confocal imaging of NIH/3T3 cells using RPSA Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: RPSA Antibody (2Q8Q6) [NBP3-16624] - Confocal imaging of HeLa cells using RPSA Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clone: 2Q8Q6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

RPSA Antibody (2Q8Q6) Summary

• Description: Novus Biologicals Rabbit RPSA Antibody (2Q8Q6) (NBP3-16624) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 196-295 of human Laminin Receptor (P08865). EVMPDLYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSEGVQVPSVPIQQFPTEDWSAQPATEDWSAAPTAQATEWVGATTDWS
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: RPSA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RPSA Antibody (2Q8Q6)

• 37 kDa laminin receptor precursor
• 37/67 kDa laminin receptor
• 37LRPNEM/1CHD4
• 67 kDa laminin receptor
• 67kD, ribosomal protein SA
• 67LR
• Colon carcinoma laminin-binding protein
• LAMBR37 kDa laminin receptor
• laminin binding protein
• laminin receptor 1 (67kD, ribosomal protein SA)
• Laminin receptor 1
• Laminin-binding protein precursor p40
• LAMR 1
• LamR
• LAMR140S ribosomal protein SA
• LBP
• LBP/p40
• LRP
• LRP/LR
• Multidrug resistance-associated protein MGr1-Ag
• p40
• ribosomal protein SA

Background

Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Many of the effects of laminin are mediated through interactions with cell surface receptors. These receptors include members of the integrin family, as well as non-integrin laminin-binding proteins. This gene encodes a high-affinity, non-integrin family, laminin receptor 1. This receptor has been variously called 67 kD laminin receptor, 37 kD laminin receptor precursor (37LRP) and p40 ribosome-associated protein. The amino acid sequence of laminin receptor 1 is highly conserved through evolution, suggesting a key biological function. It has been observed that the level of the laminin receptor transcript is higher in colon carcinoma tissue and lung cancer cell line than their normal counterparts. Also, there is a correlation between the upregulation of this polypeptide in cancer cells and their invasive and metastatic phenotype. Multiple copies of this gene exist, however, most of them are pseudogenes thought to have arisen from retropositional events. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPSA