CDCA5 Antibody

Images

 
Western Blot: CDCA5 Antibody [NBP1-89530] - Analysis in human cell line SCLC-21H.
Immunocytochemistry/ Immunofluorescence: CDCA5 Antibody [NBP1-89530] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: CDCA5 Antibody [NBP1-89530] - Staining of human bone marrow shows immune cell positivity in hematopoietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDCA5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SILPEIWPKTPSAAAVRKPIVLKRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDCA5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CDCA5 Protein (NBP1-89530PEP)
Publications
Read Publication using
NBP1-89530 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CDCA5 Antibody

  • cell division cycle associated 5
  • Cell division cycle-associated protein 5
  • MGC16386
  • p35
  • SORORIN

Background

Regulator of sister chromatid cohesion in mitosis. May act by regulating the ability of the cohesin complexto mediate sister chromatid cohesion, perhaps by altering the nature of the interaction of cohesin with thechromosomes

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CDCA5 Antibody (NBP1-89530)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IF/IHC.


Filter By Application
IF/IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CDCA5 Antibody (NBP1-89530) (0)

There are no reviews for CDCA5 Antibody (NBP1-89530). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CDCA5 Antibody (NBP1-89530) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDCA5 Products

Research Areas for CDCA5 Antibody (NBP1-89530)

Find related products by research area.

Blogs on CDCA5

There are no specific blogs for CDCA5, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDCA5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDCA5