Uroplakin IIIB Antibody

Images

 
Western Blot: Uroplakin IIIB Antibody [NBP1-92564] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA ...read more
Immunocytochemistry/ Immunofluorescence: Uroplakin IIIB Antibody [NBP1-92564] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564] - Staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelial cells.
Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564] - Embryonic mouse heart tissue. Image courtesy of customer.
Immunohistochemistry: Uroplakin IIIB Antibody [NBP1-92564] - IHC using NBP1-92564 at a dilution of 1:300 on FFPE human placenta. Primary antibody was applied overnight at 4 C. HRP conjugated secondary antibody was ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Uroplakin IIIB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ELVPYTPQITAWDLEGKVTATTFSLEQPRCVFDGLASASDTVWLVVA
Specificity
Specificity of human, mouse Uroplakin IIIB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UPK3B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Uroplakin IIIB Recombinant Protein Antigen (NBP1-92564PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-92564 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Uroplakin IIIB Antibody

  • FLJ32198
  • MGC10902
  • p35
  • UP3b
  • UPIIIB
  • UPIIIbP35
  • uroplakin 3B
  • Uroplakin IIIb
  • uroplakin-3b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37602
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1916
Species: Hu
Applications: WB, IHC, ICC
MAB7357
Species: Hu
Applications: WB
409-ML/CF
Species: Mu
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NBP2-38780
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-67117
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-83193
Species: Hu, Rt
Applications: WB, IHC, IHC-P
AF1857
Species: Mu
Applications: WB, Simple Western, IHC, IP
NBP2-25162
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92564
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Uroplakin IIIB Antibody (NBP1-92564) (0)

There are no publications for Uroplakin IIIB Antibody (NBP1-92564).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Uroplakin IIIB Antibody (NBP1-92564) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-92564:
Filter by Applications
IHC
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry Uroplakin IIIB NBP1-92564
Enlarge
reviewed by:
Peter Caradonna
IHC Human 04/03/2017
View

Summary

ApplicationImmunohistochemistry
Sample TestedPlacental tissue
SpeciesHuman

Comments

CommentsIHC using NBP1-92564 at a dilution of 1:300 on FFPE human placenta. Primary antibody was applied overnight at 4 C. HRP conjugated secondary antibody was applied for 1 hour RT, then visualized with DAB. HIER was conducted using citrate buffer pH 6.0 at 95 C for 15 minutes. Incubation of primary antibody with immunogenic peptide shows no staining in adjacent control section.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Uroplakin IIIB Antibody (NBP1-92564) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Uroplakin IIIB Antibody (NBP1-92564)

Discover related pathways, diseases and genes to Uroplakin IIIB Antibody (NBP1-92564). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Uroplakin IIIB Antibody (NBP1-92564)

Discover more about diseases related to Uroplakin IIIB Antibody (NBP1-92564).
 

Pathways for Uroplakin IIIB Antibody (NBP1-92564)

View related products by pathway.

Blogs on Uroplakin IIIB

There are no specific blogs for Uroplakin IIIB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Peter Caradonna
04/03/2017
Application: IHC
Species: Human

Bioinformatics

Gene Symbol UPK3B