Uroplakin IIIB Antibody


Western Blot: Uroplakin IIIB Antibody [NBP1-92564] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA ...read more
Immunocytochemistry/ Immunofluorescence: Uroplakin IIIB Antibody [NBP1-92564] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564] - Staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelial cells.
Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564] - Embryonic mouse heart tissue. Image courtesy of customer.
Immunohistochemistry: Uroplakin IIIB Antibody [NBP1-92564] - IHC using NBP1-92564 at a dilution of 1:300 on FFPE human placenta. Primary antibody was applied overnight at 4 C. HRP conjugated secondary antibody was ...read more

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Uroplakin IIIB Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: ELVPYTPQITAWDLEGKVTATTFSLEQPRCVFDGLASASDTVWLVVA
Specificity of human, mouse Uroplakin IIIB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Uroplakin IIIB Recombinant Protein Antigen (NBP1-92564PEP)
Reviewed Applications
Read 1 Review rated 5
NBP1-92564 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (81%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Uroplakin IIIB Antibody

  • FLJ32198
  • MGC10902
  • p35
  • UP3b
  • UPIIIbP35
  • uroplakin 3B
  • Uroplakin IIIb
  • uroplakin-3b


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB
Species: Mu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, IHC, IP
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Uroplakin IIIB Antibody (NBP1-92564) (0)

There are no publications for Uroplakin IIIB Antibody (NBP1-92564).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Uroplakin IIIB Antibody (NBP1-92564) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-92564:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry Uroplakin IIIB NBP1-92564
reviewed by:
Peter Caradonna
IHC Human 04/03/2017


Sample TestedPlacental tissue


CommentsIHC using NBP1-92564 at a dilution of 1:300 on FFPE human placenta. Primary antibody was applied overnight at 4 C. HRP conjugated secondary antibody was applied for 1 hour RT, then visualized with DAB. HIER was conducted using citrate buffer pH 6.0 at 95 C for 15 minutes. Incubation of primary antibody with immunogenic peptide shows no staining in adjacent control section.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Uroplakin IIIB Antibody (NBP1-92564) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Uroplakin IIIB Antibody (NBP1-92564)

Discover related pathways, diseases and genes to Uroplakin IIIB Antibody (NBP1-92564). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Uroplakin IIIB Antibody (NBP1-92564)

Discover more about diseases related to Uroplakin IIIB Antibody (NBP1-92564).

Pathways for Uroplakin IIIB Antibody (NBP1-92564)

View related products by pathway.

Blogs on Uroplakin IIIB

There are no specific blogs for Uroplakin IIIB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Peter Caradonna
Application: IHC
Species: Human


Gene Symbol UPK3B