RP105/CD180 Antibody

Images

 
Immunohistochemistry: RP105/CD180 Antibody [NBP1-87727] - Staining of human spleen shows strong cytoplasmic positivity in cells in white pulp.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RP105/CD180 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DFQNNAIHYISREDMRSLEQAINLSLNFNGNNVKGIELGAFDSTVFQSLNFGGTPNLSVIFNGLQNSTTQSLWLGTFEDIDDEDISSAMLKGLCEMSVESLNLQEHRFSDISSTTFQCFTQLQELDLTATHLKGLPSGMKGLNLLKKL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD180
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RP105/CD180 Protein (NBP1-87727PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RP105/CD180 Antibody

  • CD180 antigenMGC126233
  • CD180 molecule
  • CD180
  • Ly64
  • LY64MGC126234
  • Ly78
  • Lymphocyte antigen 64
  • lymphocyte antigen-64, radioprotective, 105kDa
  • Radioprotective 105 kDa protein
  • RP105
  • RP105lymphocyte antigen 64 (mouse) homolog, radioprotective, 105kD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-56700
Species: Hu, Mu
Applications: WB, IHC-P
NB100-56655
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
MAB37861
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, Simple Western, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
NBP1-87727
Species: Hu
Applications: IHC, IHC-P

Publications for RP105/CD180 Antibody (NBP1-87727) (0)

There are no publications for RP105/CD180 Antibody (NBP1-87727).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RP105/CD180 Antibody (NBP1-87727) (0)

There are no reviews for RP105/CD180 Antibody (NBP1-87727). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RP105/CD180 Antibody (NBP1-87727) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RP105/CD180 Products

Bioinformatics Tool for RP105/CD180 Antibody (NBP1-87727)

Discover related pathways, diseases and genes to RP105/CD180 Antibody (NBP1-87727). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RP105/CD180 Antibody (NBP1-87727)

Discover more about diseases related to RP105/CD180 Antibody (NBP1-87727).
 

Pathways for RP105/CD180 Antibody (NBP1-87727)

View related products by pathway.

PTMs for RP105/CD180 Antibody (NBP1-87727)

Learn more about PTMs related to RP105/CD180 Antibody (NBP1-87727).
 

Research Areas for RP105/CD180 Antibody (NBP1-87727)

Find related products by research area.

Blogs on RP105/CD180

There are no specific blogs for RP105/CD180, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RP105/CD180 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD180
Entrez