ROR gamma/RORC/NR1F3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ROR gamma/RORC/NR1F3 Antibody [NBP2-56610] - Staining of human cell line HeLa shows localization to nuclear bodies.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ROR gamma/RORC/NR1F3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYV
Specificity
Specificity of human ROR gamma/RORC/NR1F3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RORC
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ROR gamma/RORC/NR1F3 Recombinant Protein Antigen (NBP2-56610PEP)

Reactivity Notes

Mouse 87%, Rat 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ROR gamma/RORC/NR1F3 Antibody

  • MGC129539
  • NR1F3
  • Nuclear receptor ROR gamma
  • Nuclear receptor ROR-gamma
  • Nuclear receptor RZR gamma
  • Nuclear receptor RZR-gamma
  • Nuclear receptor subfamily 1 group F member 3
  • RAR-Related Orphan Nuclear Receptor Variant 2
  • RAR-related orphan receptor C
  • RAR-related orphan receptor gamma
  • retinoic acid-binding receptor gamma
  • retinoid-related orphan receptor gamma
  • Retinoid-related orphan receptor-gamma
  • ROR gamma
  • RORC
  • RORG
  • RORGMGC129539
  • RZRG
  • RZRGRZR-GAMMA
  • TOR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-111
Species: Hu, Mu(-)
Applications: WB, ICC/IF, IHC, IHC-Fr
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-89865
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-1595
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22356
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-24837
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1049
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-39002
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western
NB100-2315
Species: Hu, Mu
Applications: WB, IP
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53246
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P, KO

Publications for ROR gamma/RORC/NR1F3 Antibody (NBP2-56610) (0)

There are no publications for ROR gamma/RORC/NR1F3 Antibody (NBP2-56610).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ROR gamma/RORC/NR1F3 Antibody (NBP2-56610) (0)

There are no reviews for ROR gamma/RORC/NR1F3 Antibody (NBP2-56610). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ROR gamma/RORC/NR1F3 Antibody (NBP2-56610). (Showing 1 - 2 of 2 FAQ).

  1. Does ROR gamma/RORC/NR1F3 antibodies comes in lyophilized form?
    • Yes, we have 3 RORC antibodies delivere in lyophilized form: MAB61091, MAB61092, MAB6109.
  2. What the theoretical molecular weight for ROR gamma/RORC/NR1F3 antibodies?
    • The TMW of ROR gamma/RORC/NR1F3 antibodies is approximately 56 - 60.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ROR gamma/RORC/NR1F3 Products

Bioinformatics Tool for ROR gamma/RORC/NR1F3 Antibody (NBP2-56610)

Discover related pathways, diseases and genes to ROR gamma/RORC/NR1F3 Antibody (NBP2-56610). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ROR gamma/RORC/NR1F3 Antibody (NBP2-56610)

Discover more about diseases related to ROR gamma/RORC/NR1F3 Antibody (NBP2-56610).
 

Pathways for ROR gamma/RORC/NR1F3 Antibody (NBP2-56610)

View related products by pathway.

PTMs for ROR gamma/RORC/NR1F3 Antibody (NBP2-56610)

Learn more about PTMs related to ROR gamma/RORC/NR1F3 Antibody (NBP2-56610).
 

Research Areas for ROR gamma/RORC/NR1F3 Antibody (NBP2-56610)

Find related products by research area.

Blogs on ROR gamma/RORC/NR1F3

There are no specific blogs for ROR gamma/RORC/NR1F3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ROR gamma/RORC/NR1F3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RORC