TORC1 Antibody

Images

 
Western Blot: TORC1 Antibody [NBP1-89865] - Analysis in mouse cell line NIH-3T3 cell and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: TORC1 Antibody [NBP1-89865] - Staining of human cell line A-431 shows localization to nucleoplasm, nuclear bodies, plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TORC1 Antibody [NBP1-89865] - Staining of human testis shows strong nuclear positivity in a subset of cells in seminiferous ducts.
Western Blot: TORC1 Antibody [NBP1-89865] - Analysis in human cell line BEWO.
Immunohistochemistry-Paraffin: TORC1 Antibody [NBP1-89865] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.
Immunohistochemistry-Paraffin: TORC1 Antibody [NBP1-89865] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: TORC1 Antibody [NBP1-89865] - Staining of human prostate shows strong nuclear positivity in smooth muscle cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TORC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTGSRPKSCEV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRTC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TORC1 Protein (NBP1-89865PEP)
Publications
Read Publication using NBP1-89865.

Reactivity Notes

Rat (86%), Mouse (84%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TORC1 Antibody

  • CREB regulated transcription coactivator 1
  • CRTC1
  • FLJ14027WAMTP1
  • KIAA0616Transducer of regulated cAMP response element-binding protein 1
  • MECT1
  • MECT1CREB-regulated transcription coactivator 1
  • mucoepidermoid carcinoma translocated 1
  • Mucoepidermoid carcinoma translocated protein 1
  • TORC1
  • TORC1TORC-1
  • Transducer of CREB protein 1
  • transducer of regulated cAMP response element-binding protein (CREB) 1
  • WAMTP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP2-22356
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-24503
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
NB100-1595
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
MAB40401
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP2-89142
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-46234
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-53228
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB600-1049
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-51645
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-33116
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
DBD00
Species: Hu
Applications: ELISA
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB200-157
Species: Hu
Applications: IHC, IHC-P, KO, WB

Publications for TORC1 Antibody (NBP1-89865)(1)

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
All Species

Reviews for TORC1 Antibody (NBP1-89865) (0)

There are no reviews for TORC1 Antibody (NBP1-89865). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TORC1 Antibody (NBP1-89865) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TORC1 Products

Bioinformatics Tool for TORC1 Antibody (NBP1-89865)

Discover related pathways, diseases and genes to TORC1 Antibody (NBP1-89865). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TORC1 Antibody (NBP1-89865)

Discover more about diseases related to TORC1 Antibody (NBP1-89865).
 

Pathways for TORC1 Antibody (NBP1-89865)

View related products by pathway.

PTMs for TORC1 Antibody (NBP1-89865)

Learn more about PTMs related to TORC1 Antibody (NBP1-89865).
 

Research Areas for TORC1 Antibody (NBP1-89865)

Find related products by research area.

Blogs on TORC1

There are no specific blogs for TORC1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TORC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRTC1