TORC1 Antibody


Western Blot: TORC1 Antibody [NBP1-89865] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: TORC1 Antibody [NBP1-89865] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, nuclear bodies, plasma membrane & cytosol. Antibody staining more
Immunohistochemistry-Paraffin: TORC1 Antibody [NBP1-89865] - Staining of human kidney shows strong nuclear and cytoplasmic positivity in distal tubules.
Western Blot: TORC1 Antibody [NBP1-89865] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

TORC1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTGSRPKSCEV
Specificity of human, mouse, rat TORC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TORC1 Protein (NBP1-89865PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TORC1 Antibody

  • CREB regulated transcription coactivator 1
  • CRTC1
  • FLJ14027WAMTP1
  • KIAA0616Transducer of regulated cAMP response element-binding protein 1
  • MECT1
  • MECT1CREB-regulated transcription coactivator 1
  • mucoepidermoid carcinoma translocated 1
  • Mucoepidermoid carcinoma translocated protein 1
  • TORC1
  • Transducer of CREB protein 1
  • transducer of regulated cAMP response element-binding protein (CREB) 1
  • WAMTP1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA, ICC
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TORC1 Antibody (NBP1-89865) (0)

There are no publications for TORC1 Antibody (NBP1-89865).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TORC1 Antibody (NBP1-89865) (0)

There are no reviews for TORC1 Antibody (NBP1-89865). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TORC1 Antibody (NBP1-89865) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TORC1 Products

Bioinformatics Tool for TORC1 Antibody (NBP1-89865)

Discover related pathways, diseases and genes to TORC1 Antibody (NBP1-89865). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TORC1 Antibody (NBP1-89865)

Discover more about diseases related to TORC1 Antibody (NBP1-89865).

Pathways for TORC1 Antibody (NBP1-89865)

View related products by pathway.

PTMs for TORC1 Antibody (NBP1-89865)

Learn more about PTMs related to TORC1 Antibody (NBP1-89865).

Research Areas for TORC1 Antibody (NBP1-89865)

Find related products by research area.

Blogs on TORC1

There are no specific blogs for TORC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TORC1 Antibody and receive a gift card or discount.


Gene Symbol CRTC1