RNF34 Antibody

Images

 
Western Blot: RNF34 Antibody [NBP2-56413] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: RNF34 Antibody [NBP2-56413] - Staining of human cell line CACO-2 shows localization to nuclear bodies. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF34 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NIVCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDL
Specificity
Specificity of human RNF34 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF34
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunoprecipitation
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in immunoprecipitation reported in scientific literature (PMID:31209065).
Control Peptide
RNF34 Recombinant Protein Antigen (NBP2-56413PEP)
Publications
Read Publications using
NBP2-56413 in the following applications:

  • IP
    1 publication
  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RNF34 Antibody

  • CARP1
  • Caspase regulator CARP1
  • Caspases-8 and -10-associated RING finger protein 1
  • E3 ubiquitin-protein ligase RNF34
  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ21786
  • FYVE-RING finger protein Momo
  • hRFI
  • Human RING finger homologous to inhibitor of apoptosis protein
  • RFI
  • RIF
  • RIFF
  • ring finger protein 34CARP-1
  • RING finger protein RIFF

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NB100-1813
Species: Hu
Applications: WB, ICC/IF, IP
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-24689
Species: Hu, Mu
Applications: WB
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1107
Species: Mu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00003347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-66958
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01800
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2187
Species: Hu, Mu
Applications: WB, Simple Western, IP
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56183
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88543
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-80870
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP2-56413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP

Publications for RNF34 Antibody (NBP2-56413)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IP, WB.


Filter By Application
IP
(1)
WB
(2)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for RNF34 Antibody (NBP2-56413) (0)

There are no reviews for RNF34 Antibody (NBP2-56413). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RNF34 Antibody (NBP2-56413) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RNF34 Products

Bioinformatics Tool for RNF34 Antibody (NBP2-56413)

Discover related pathways, diseases and genes to RNF34 Antibody (NBP2-56413). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF34 Antibody (NBP2-56413)

Discover more about diseases related to RNF34 Antibody (NBP2-56413).
 

Pathways for RNF34 Antibody (NBP2-56413)

View related products by pathway.

PTMs for RNF34 Antibody (NBP2-56413)

Learn more about PTMs related to RNF34 Antibody (NBP2-56413).
 

Research Areas for RNF34 Antibody (NBP2-56413)

Find related products by research area.

Blogs on RNF34

There are no specific blogs for RNF34, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF34 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF34