Histatin 3 Antibody (4G9)

Immunocytochemistry/Immunofluorescence: Histatin 3 Antibody (4G9) [H00003347-M01] - Analysis of monoclonal antibody to HTN3 on HeLa cell . Antibody concentration 10 ug/ml.

Sandwich ELISA: Histatin 3 Antibody (4G9) [H00003347-M01] - Detection limit for recombinant GST tagged HTN3 is approximately 3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, S-ELISA
• Clone: 4G9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

Histatin 3 Antibody (4G9) Summary

• Immunogen: HTN3 (AAH09791, 1 a.a. ~ 51 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN
• Specificity: HTN3 - histatin 3 (4G9)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HTN3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
  • Western Blot
• Application Notes: Antibody reactivity against recombinant protein with GST tag on ELISA. GST tag alone is used as a negative control. Use in Western blot reported in scientific literature (PMID: 28055279).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Histatin 3 Antibody (4G9)

• Basic histidine-rich protein
• HIS2histatin 5
• histatin 3
• histatin-3
• Histidine-rich protein 3
• hst
• HTN2
• HTN5
• PB

Background

The primary protein encoded by HTN3 is histatin 3. Histatins are a family of small, histidine-rich, salivary proteins, encoded by at least two loci (HTN3 and HTN1). Post-translational proteolyitic processing results in many histatins: e.g., histatins 4-6 are derived from histatin 3 by proteolysis. Histatins are believed to have important non-immunological, anti-microbial function in the oral cavity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Histatin 3 Antibody (H00003347-M01)(1)

Publication using H00003347-M01

• Marvin RK, Saepoo MB, Ye S et al. Salivary protein changes in response to acute stress in medical residents performing advanced clinical simulations: a pilot proteomics study. Biomarkers 2017-01-25 [PMID: 28055279] (WB)

Bioinformatics

• Gene Symbol: HTN3
• Entrez:
  • 3347(Human)
• Uniprot:
  • AAH09791(Human)