Histatin 3 Antibody (4G9)


Immunocytochemistry/ Immunofluorescence: Histatin 3 Antibody (4G9) [H00003347-M01] - Analysis of monoclonal antibody to HTN3 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: Histatin 3 Antibody (4G9) [H00003347-M01] - Detection limit for recombinant GST tagged HTN3 is approximately 3ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA

Order Details

Histatin 3 Antibody (4G9) Summary

HTN3 (AAH09791, 1 a.a. ~ 51 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN
HTN3 - histatin 3 (4G9)
IgG2b Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
Application Notes
Antibody reactivity against recombinant protein with GST tag on ELISA. GST tag alone is used as a negative control. Use in Western blot reported in scientific literature (PMID: 28055279).
Read Publication using H00003347-M01.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
In 1x PBS, pH 7.4
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Histatin 3 Antibody (4G9)

  • Basic histidine-rich protein
  • HIS2histatin 5
  • histatin 3
  • histatin-3
  • Histidine-rich protein 3
  • hst
  • HTN2
  • HTN5
  • PB


The primary protein encoded by HTN3 is histatin 3. Histatins are a family of small, histidine-rich, salivary proteins, encoded by at least two loci (HTN3 and HTN1). Post-translational proteolyitic processing results in many histatins: e.g., histatins 4-6 are derived from histatin 3 by proteolysis. Histatins are believed to have important non-immunological, anti-microbial function in the oral cavity. [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Mu, Fe
Applications: WB, IHC, IHC-P
Species: Hu, Pm
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Po, V-Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB

Publications for Histatin 3 Antibody (H00003347-M01)(1)

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for Histatin 3 Antibody (H00003347-M01) (0)

There are no reviews for Histatin 3 Antibody (H00003347-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Histatin 3 Antibody (H00003347-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Histatin 3 Products

Bioinformatics Tool for Histatin 3 Antibody (H00003347-M01)

Discover related pathways, diseases and genes to Histatin 3 Antibody (H00003347-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Histatin 3 Antibody (H00003347-M01)

Discover more about diseases related to Histatin 3 Antibody (H00003347-M01).

Pathways for Histatin 3 Antibody (H00003347-M01)

View related products by pathway.

PTMs for Histatin 3 Antibody (H00003347-M01)

Learn more about PTMs related to Histatin 3 Antibody (H00003347-M01).

Blogs on Histatin 3

There are no specific blogs for Histatin 3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Histatin 3 Antibody (4G9) and receive a gift card or discount.


Gene Symbol HTN3