MRP2 Antibody

Western Blot: MRP2 Antibody [NBP1-69023] - Sample Tissue: Mouse Thymus Antibody Dilution: 1.0ug/ml

Western Blot: MRP2 Antibody [NBP1-69023] - Mouse Spleen lysate, concentration 0.2-1 ug/ml.

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Concentration: 0.5 mg/ml

MRP2 Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to Abcc2 (ATP-binding cassette, sub-family C (CFTR/MRP), member 2) The peptide sequence was selected from the middle region of Abcc2 (NP_038834). Peptide sequence TIQDVNLDIKPGQLVAVVGTVGSGKSSLISAMLGEMENVHGHITIKGSIA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: Abcc2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 174 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MRP2 Antibody

• ABC30
• ABCC2
• ATP-binding cassette, sub-family C (CFTR/MRP), member 2
• Canalicular multidrug resistance protein
• canalicular multispecific organic anion transporter 1
• CMOAT
• CMOAT1
• CMOATABC30
• cMRP
• DJS
• KIAA1010
• MRP2
• MRP2ATP-binding cassette sub-family C member 2
• Multidrug resistance-associated protein 2

Background

Abcc2 mediates hepatobiliary excretion of numerous organic anions. Abcc2 may function as a cellular cisplatin transporter.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MRP2 Antibody (NBP1-69023)(3)

Publications using NBP1-69023

• Huang J, Liao S, Fu X et al. Running title: AMPK contributes to liver injury Journal of applied toxicology : JAT 2023-02-27 [PMID: 36846903]
• Doganlar O, Doganlar ZB, Erdogan S, Delen E Antineoplastic multi-drug chemotherapy to sensitize tumors triggers multi-drug resistance and inhibits efficiency of maintenance treatment inglioblastoma cells EXCLI journal 2023-01-04 [PMID: 36660193] (WB, Human)
• Untereiner AA, Fu M, Modis K et al. Stimulatory effect of CSE-generated H2S on hepatic mitochondrial biogenesis and the underlying mechanisms. Nitric Oxide 2016-06-27 [PMID: 27364855] (WB, Mouse)

Bioinformatics

• Gene Symbol: Abcc2
• Entrez:
  • 1244(Human)
  • 12780(Mouse)
• Uniprot:
  • Q8VI47(Mouse)