MRP2 Antibody

Images

 
Western Blot: MRP2 Antibody [NBP1-69023] - Sample Tissue: Mouse Thymus Antibody Dilution: 1.0ug/ml
Western Blot: MRP2 Antibody [NBP1-69023] - Mouse Spleen lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRP2 Antibody Summary

Immunogen
Synthetic peptides corresponding to Abcc2 (ATP-binding cassette, sub-family C (CFTR/MRP), member 2) The peptide sequence was selected from the middle region of Abcc2 (NP_038834). Peptide sequence TIQDVNLDIKPGQLVAVVGTVGSGKSSLISAMLGEMENVHGHITIKGSIA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
Abcc2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Abcc2 and was validated on Western blot.
Theoretical MW
174 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-69023 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MRP2 Antibody

  • ATP-binding cassette, sub-family C (CFTR/MRP), member 2
  • Canalicular multidrug resistance protein
  • canalicular multispecific organic anion transporter 1
  • CMOAT1
  • CMOATABC30
  • cMRP
  • DJS
  • KIAA1010
  • MRP2ATP-binding cassette sub-family C member 2
  • Multidrug resistance-associated protein 2

Background

Abcc2 mediates hepatobiliary excretion of numerous organic anions. Abcc2 may function as a cellular cisplatin transporter.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-46466
Species: Hu
Applications: IHC
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-556
Species: Hu
Applications: WB, IP
NBP1-31824
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-74482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-30887
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-94881
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-56965
Species: Hu
Applications: WB, ICC/IF
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-92393
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-69023
Species: Mu
Applications: WB

Publications for MRP2 Antibody (NBP1-69023)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for MRP2 Antibody (NBP1-69023) (0)

There are no reviews for MRP2 Antibody (NBP1-69023). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRP2 Antibody (NBP1-69023) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRP2 Products

MRP2 NBP1-69023

Bioinformatics Tool for MRP2 Antibody (NBP1-69023)

Discover related pathways, diseases and genes to MRP2 Antibody (NBP1-69023). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRP2 Antibody (NBP1-69023)

Discover more about diseases related to MRP2 Antibody (NBP1-69023).
 

Pathways for MRP2 Antibody (NBP1-69023)

View related products by pathway.

PTMs for MRP2 Antibody (NBP1-69023)

Learn more about PTMs related to MRP2 Antibody (NBP1-69023).

Blogs on MRP2

There are no specific blogs for MRP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol Abcc2
Entrez
Uniprot