Ribosomal Protein L17 Antibody

Images

 
Western Blot: Ribosomal Protein L17 Antibody [NBP1-74075] - Mouse Liver Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ribosomal Protein L17 Antibody Summary

Immunogen
Synthetic peptides corresponding to the N terminal of Rpl17. Immunizing peptide sequence SLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPL17
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Rpl17 and was validated on Western blot.
Theoretical MW
20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Ribosomal Protein L17 Antibody

  • FLJ18762,60S ribosomal protein L23
  • FLJ92089
  • gene encoding putative NFkB activating protein
  • MGC117162
  • PD-1
  • Ribosomal Protein L17
  • RPL17
  • RPL23
  • RPL23,60S ribosomal protein L17

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-76769
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1086
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-76770
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
MAB342
Species: Hu
Applications: WB, AgAct
MAB69752
Species: Hu
Applications: B/N, Flow, CyTOF-ready
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2365
Species: Hu
Applications: WB, Flow, CyTOF-ready
MAB141
Species: Hu
Applications: WB, Flow, CyTOF-ready, KO, Neut

Publications for Ribosomal Protein L17 Antibody (NBP1-74075) (0)

There are no publications for Ribosomal Protein L17 Antibody (NBP1-74075).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ribosomal Protein L17 Antibody (NBP1-74075) (0)

There are no reviews for Ribosomal Protein L17 Antibody (NBP1-74075). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ribosomal Protein L17 Antibody (NBP1-74075) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Ribosomal Protein L17 Antibody (NBP1-74075)

Discover related pathways, diseases and genes to Ribosomal Protein L17 Antibody (NBP1-74075). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ribosomal Protein L17 Antibody (NBP1-74075)

Discover more about diseases related to Ribosomal Protein L17 Antibody (NBP1-74075).
 

Pathways for Ribosomal Protein L17 Antibody (NBP1-74075)

View related products by pathway.

Blogs on Ribosomal Protein L17

There are no specific blogs for Ribosomal Protein L17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ribosomal Protein L17 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL17
Entrez
Uniprot