RBM26 Antibody - BSA Free

Western Blot: RBM26 Antibody [NBP1-89007] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.

Immunocytochemistry/Immunofluorescence: RBM26 Antibody [NBP1-89007] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.

Immunohistochemistry-Paraffin: RBM26 Antibody [NBP1-89007] - Staining of human rectum shows strong nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RBM26 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RBM26 Antibody - BSA Free (NBP1-89007) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PPLTPLQPSGMDAPPNSATSSVPTVVTTGIHHQPPPAPPSLFTADTYDTDGY
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBM26
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RBM26 Protein (NBP1-89007PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RBM26 Antibody - BSA Free

• acidic rich RS domain containing 2
• ARRS2
• C13orf10
• chromosome 13 open reading frame 10
• CTCL tumor antigen se70-2
• cutaneous T-cell lymphoma tumor antigen se70-2
• FLJ20957
• MGC133295
• MGC133296
• PRO1777
• RNA binding motif protein 26
• RNA-binding motif protein 26
• RNA-binding protein 26
• RP11-255E21.1
• SE70-2
• ZC3H17

Background

RBM26 (RNA binding motif protein 26) bears two RNA recognition motif (RRM) domains and a C3H1-type zinc finger. The function of RBM26 has not been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RBM26