Cdk6 Antibody

Images

 
Western Blot: Cdk6 Antibody [NBP1-87262] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: Cdk6 Antibody [NBP1-87262] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Cdk6 Antibody [NBP1-87262] - Staining of human bone marrow shows strong nuclear positivity in bone marrow poietic cells.
Western Blot: Cdk6 Antibody [NBP1-87262] - Analysis in human cell line MOLT-4.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cdk6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDK6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cdk6 Protein (NBP1-87262PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cdk6 Antibody

  • Cell division protein kinase 6
  • cyclin-dependent kinase 6
  • EC 2.7.11
  • EC 2.7.11.22
  • PLSTIREMGC59692
  • Serine/threonine-protein kinase PLSTIRE

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
AF1555
Species: Hu
Applications: WB
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP1-31806
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NB120-3216
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-87262
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Cdk6 Antibody (NBP1-87262) (0)

There are no publications for Cdk6 Antibody (NBP1-87262).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cdk6 Antibody (NBP1-87262) (0)

There are no reviews for Cdk6 Antibody (NBP1-87262). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cdk6 Antibody (NBP1-87262) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cdk6 Products

Bioinformatics Tool for Cdk6 Antibody (NBP1-87262)

Discover related pathways, diseases and genes to Cdk6 Antibody (NBP1-87262). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cdk6 Antibody (NBP1-87262)

Discover more about diseases related to Cdk6 Antibody (NBP1-87262).
 

Pathways for Cdk6 Antibody (NBP1-87262)

View related products by pathway.

PTMs for Cdk6 Antibody (NBP1-87262)

Learn more about PTMs related to Cdk6 Antibody (NBP1-87262).
 

Research Areas for Cdk6 Antibody (NBP1-87262)

Find related products by research area.

Blogs on Cdk6

There are no specific blogs for Cdk6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cdk6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK6