Cdk6 Antibody - BSA Free

Immunohistochemistry-Paraffin: Cdk6 Antibody [NBP1-87262] - Analysis in human placenta and skeletal muscle tissues. Corresponding CDK6 RNA-seq data are presented for the same tissues.

Western Blot: Cdk6 Antibody [NBP1-87262] - Analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Immunocytochemistry/Immunofluorescence: Cdk6 Antibody [NBP1-87262] - Staining of human cell line U-251 MG shows localization to nucleoplasm and cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Cdk6 Antibody [NBP1-87262] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Western Blot: Cdk6 Antibody [NBP1-87262] - Analysis in human cell lines U2OS and A-549. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

Immunohistochemistry-Paraffin: Cdk6 Antibody [NBP1-87262] - Staining of human lymph node shows moderate to strong cytoplasmic positivity in germinal center cells.

Immunohistochemistry-Paraffin: Cdk6 Antibody [NBP1-87262] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Cdk6 Antibody [NBP1-87262] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cdk6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Cdk6 Antibody - BSA Free (NBP1-87262) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Cdk6 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELN
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDK6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Cdk6 Protein (NBP1-87262PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Cdk6 Antibody - BSA Free

• Cdk6
• CDKN6
• Cell division protein kinase 6
• cyclin-dependent kinase 6
• EC 2.7.11
• EC 2.7.11.22
• PLSTIREMGC59692
• Serine/threonine-protein kinase PLSTIRE

Background

Cdk6 is encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity of this kinase first appears in mid-G1 phase, which is controlled by the regulatory subunits including D-type cyclins and members of INK4 family of CDK inhibitors. This kinase, as well as CDK4, has been shown to phosphorylate, and thus regulate the activity of, tumor suppressor protein Rb.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cdk6 Antibody (NBP1-87262)(3)

Publications using NBP1-87262

• Liang R, Arif T, Kalmykova S et al. Restraining Lysosomal Activity Preserves Hematopoietic Stem Cell Quiescence and Potency Cell Stem Cell 2020-03-05 [PMID: 32109377]
• Sikorski K, Mehta A et al. A high-throughput pipeline for validation of antibodies. Nat Methods 2018-01-11 [PMID: 30377371] (Human)
  
  Details:
  Antibody validation based on denaturing gel electrophoresis of biotinylated cell lysates (PAGE) followed by mass spectrometry (MS) and antibody array analysis (MAP).
• Ahonen M, Haridas P, Mysore R et al. miR-107 inhibits CDK6 expression, differentiation, and lipid storage in human adipocytes. Mol. Cell. Endocrinol. 2018-09-24 [PMID: 30261211] (WB, Human)

Bioinformatics

• Gene Symbol: CDK6