EHD3 Antibody (4B7)

Images

 
Western Blot: EHD3 Antibody (4B7) [H00030845-M01] - EHD3 monoclonal antibody (M01), clone 4B7 Analysis of EHD3 expression in IMR-32.
Immunocytochemistry/ Immunofluorescence: EHD3 Antibody (4B7) [H00030845-M01] - Analysis of monoclonal antibody to EHD3 on HeLa cell. Antibody concentration 25 ug/ml.
Immunohistochemistry-Paraffin: EHD3 Antibody (4B7) [H00030845-M01] - Analysis of monoclonal antibody to EHD3 on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml.
Western Blot: EHD3 Antibody (4B7) [H00030845-M01] - EHD3 monoclonal antibody (M01), clone 4B7. Analysis of EHD3 expression in COLO 320 HSR.
Western Blot: EHD3 Antibody (4B7) [H00030845-M01] - EHD3 monoclonal antibody (M01), clone 4B7. Analysis of EHD3 expression in MCF-7.
ELISA: EHD3 Antibody (4B7) [H00030845-M01] - Detection limit for recombinant GST tagged EHD3 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
4B7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

EHD3 Antibody (4B7) Summary

Immunogen
EHD3 (NP_055415, 357 a.a. ~ 406 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPI
Specificity
EHD3 - EH-domain containing 3
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EHD3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Publications
Read Publication using H00030845-M01.

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EHD3 Antibody (4B7)

  • EH domain containing 3
  • EH domain-containing protein 3
  • EHD2
  • EH-domain containing 3
  • PAST homolog 3
  • PAST3

Background

The deduced protein identities between EHD1 and EHD2, between EHD1 and EHD3, and between EHD1 and EHD4, are 71%, 86%, and 76%, respectively. All contain multiple conserved regions that include a nucleotide binding consensus site at the N terminus, a bipartite nuclear localization signal, and an eps15 homology (EH) protein binding domain with an EF hand motif at the C terminus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56035
Species: Hu
Applications: ICC/IF, KO, WB
MAB8480
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
NBP1-54873
Species: Hu, Rt
Applications: IHC, IHC-P, WB
2914-HT
Species: Hu
Applications: BA
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP2-49320
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13723
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-82949
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-66814
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB7650
Species: Mu
Applications: IHC, WB
NBP1-93614
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF3470
Species: Hu
Applications: ICC, WB
AF6116
Species: Hu
Applications: ICC, WB
NBP2-75458
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, IP, WB
NBP1-88932
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
H00030845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for EHD3 Antibody (H00030845-M01)(1)

Reviews for EHD3 Antibody (H00030845-M01) (0)

There are no reviews for EHD3 Antibody (H00030845-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EHD3 Antibody (H00030845-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EHD3 Products

Bioinformatics Tool for EHD3 Antibody (H00030845-M01)

Discover related pathways, diseases and genes to EHD3 Antibody (H00030845-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EHD3 Antibody (H00030845-M01)

Discover more about diseases related to EHD3 Antibody (H00030845-M01).
 

Pathways for EHD3 Antibody (H00030845-M01)

View related products by pathway.

PTMs for EHD3 Antibody (H00030845-M01)

Learn more about PTMs related to EHD3 Antibody (H00030845-M01).

Blogs on EHD3

There are no specific blogs for EHD3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EHD3 Antibody (4B7) and receive a gift card or discount.

Bioinformatics

Gene Symbol EHD3
Entrez
OMIM
Uniprot