RanGAP1 Antibody - BSA Free

Western Blot: RanGAP1 Antibody [NBP2-56215] - Analysis using Anti-RANGAP1 antibody NBP2-56215 (A) shows similar pattern to independent antibody NBP2-33591 (B).

Immunocytochemistry/Immunofluorescence: RanGAP1 Antibody [NBP2-56215] - Staining of human cell line U-2 OS shows localization to nuclear membrane, cytosol & vesicles.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RanGAP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RanGAP1 Antibody - BSA Free (NBP2-56215) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NFGDCLVRSKGAVAIADAIRGGLPKLKELNLSFCEIKRDAALAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEGFNMAKVLASLSDD
• Predicted Species: Mouse (92%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RANGAP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RanGAP1 Recombinant Protein Antigen (NBP2-56215PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RanGAP1 Antibody - BSA Free

• Fug1
• KIAA1835Fug1
• MGC20266
• Ran GTPase activating protein 1
• ran GTPase-activating protein 1
• RanGAP1
• SD
• segregation distorter homolog (Drosophila)
• segregation distorter homolog
• segregation distortion

Background

RanGAP1, is a homodimeric 65-kD polypeptide that specifically induces the GTPase activity of RAN, but not of RAS by over 1,000-fold. RanGAP1 is the immediate antagonist of RCC1, a regulator molecule that keeps RAN in the active, GTP-bound state. The RANGAP1 gene encodes a 587-amino acid polypeptide. The sequence is unrelated to that of GTPase activators for other RAS-related proteins, but is 88% identical to Fug1, the murine homolog of yeast Rna1p. RanGAP1 and RCC1 control RAN-dependent transport between the nucleus and cytoplasm. RanGAP1 is a key regulator of the RAN GTP/GDP cycle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RANGAP1