RanGAP1 Antibody (1E7R7)

Western Blot: RanGAP1 Antibody (1E7R7) [NBP3-16697] - Western blot analysis of extracts of various cell lines, using RanGAP1 Rabbit mAb (NBP3-16697) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Immunocytochemistry/Immunofluorescence: RanGAP1 Antibody (1E7R7) [NBP3-16697] - Immunofluorescence analysis of U-2 OS cells using RanGAP1 Rabbit mAb (NBP3-16697) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: RanGAP1 Antibody (1E7R7) [NBP3-16697] - Immunofluorescence analysis of C6 cells using RanGAP1 Rabbit mAb (NBP3-16697) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: RanGAP1 Antibody (1E7R7) [NBP3-16697] - Immunofluorescence analysis of NIH-3T3 cells using RanGAP1 Rabbit mAb (NBP3-16697) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry: RanGAP1 Antibody (1E7R7) [NBP3-16697] - Immunohistochemistry analysis of RanGAP1 in paraffin-embedded rat testis tissue using RanGAP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: RanGAP1 Antibody (1E7R7) [NBP3-16697] - Immunohistochemistry analysis of RanGAP1 in paraffin-embedded mouse kidney tissue using RanGAP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: RanGAP1 Antibody (1E7R7) [NBP3-16697] - Immunohistochemistry analysis of RanGAP1 in paraffin-embedded rat liver tissue using RanGAP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: RanGAP1 Antibody (1E7R7) [NBP3-16697] - Immunofluorescence analysis of NIH-3T3 cells using RanGAP1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: RanGAP1 Antibody (1E7R7) [NBP3-16697] - Immunohistochemistry analysis of RanGAP1 in paraffin-embedded human colon carcinoma tissue using RanGAP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: RanGAP1 Antibody (1E7R7) [NBP3-16697] - Immunohistochemistry analysis of RanGAP1 in paraffin-embedded mouse brain tissue using RanGAP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 1E7R7
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

RanGAP1 Antibody (1E7R7) Summary

• Description: Novus Biologicals Rabbit RanGAP1 Antibody (1E7R7) (NBP3-16697) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RanGAP1 (P46060). MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPAL
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: RANGAP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RanGAP1 Antibody (1E7R7)

• Fug1
• KIAA1835Fug1
• MGC20266
• Ran GTPase activating protein 1
• ran GTPase-activating protein 1
• RanGAP1
• SD
• segregation distorter homolog (Drosophila)
• segregation distorter homolog
• segregation distortion

Background

RanGAP1, is a homodimeric 65-kD polypeptide that specifically induces the GTPase activity of RAN, but not of RAS by over 1,000-fold. RanGAP1 is the immediate antagonist of RCC1, a regulator molecule that keeps RAN in the active, GTP-bound state. The RANGAP1 gene encodes a 587-amino acid polypeptide. The sequence is unrelated to that of GTPase activators for other RAS-related proteins, but is 88% identical to Fug1, the murine homolog of yeast Rna1p. RanGAP1 and RCC1 control RAN-dependent transport between the nucleus and cytoplasm. RanGAP1 is a key regulator of the RAN GTP/GDP cycle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RANGAP1