RAB8A Antibody


Western Blot: RAB8A Antibody [NBP1-79960] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: RAB8A Antibody [NBP1-79960] - HeLa, Vera, HeLa transfected with mouse construct, Antibody Titration: 0.2-1 ug/ml
Western Blot: RAB8A Antibody [NBP1-79960] - Lane 1. Human Cervical Cancer Cell lysate (15ug) 2. Monkey Fibroblast Cell lysate (15ug) 3. Human Cervical Cancer Cell transfected with mouse Rab8A-GFP (15ug) at 1 : 1000.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB

Order Details

RAB8A Antibody Summary

Synthetic peptide directed towards the middle region of human RAB8AThe immunogen for this antibody is RAB8A. Peptide sequence GIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITP.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against RAB8A and was validated on Western blot.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
RAB8A Lysate (NBP2-64934)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RAB8A Antibody

  • mel transforming oncogene (derived from cell line NK14)- RAB8 homolog
  • mel transforming oncogene (derived from cell line NK14)
  • MELras-associated protein RAB8
  • Oncogene c-mel
  • RAB8A, member RAS oncogene family
  • RAB8mel transforming oncogene (RAB8 homolog)
  • ras-related protein Rab-8A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
Species: Hu, Ze
Applications: WB, ChIP, ELISA
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RAB8A Antibody (NBP1-79960) (0)

There are no publications for RAB8A Antibody (NBP1-79960).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB8A Antibody (NBP1-79960) (0)

There are no reviews for RAB8A Antibody (NBP1-79960). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB8A Antibody (NBP1-79960) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for RAB8A Antibody (NBP1-79960)

Discover related pathways, diseases and genes to RAB8A Antibody (NBP1-79960). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB8A Antibody (NBP1-79960)

Discover more about diseases related to RAB8A Antibody (NBP1-79960).

Pathways for RAB8A Antibody (NBP1-79960)

View related products by pathway.

PTMs for RAB8A Antibody (NBP1-79960)

Learn more about PTMs related to RAB8A Antibody (NBP1-79960).

Blogs on RAB8A

There are no specific blogs for RAB8A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RAB8A Antibody and receive a gift card or discount.


Gene Symbol RAB8A