RAB8A Antibody

Images

 
Western Blot: RAB8A Antibody [NBP1-79960] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: RAB8A Antibody [NBP1-79960] - HeLa, Vera, HeLa transfected with mouse construct, Antibody Titration: 0.2-1 ug/ml
Western Blot: RAB8A Antibody [NBP1-79960] - Lane 1. Human Cervical Cancer Cell lysate (15ug) 2. Monkey Fibroblast Cell lysate (15ug) 3. Human Cervical Cancer Cell transfected with mouse Rab8A-GFP (15ug) at 1 : 1000.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAB8A Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human RAB8AThe immunogen for this antibody is RAB8A. Peptide sequence GIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB8A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against RAB8A and was validated on Western blot.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
RAB8A Lysate (NBP2-64934)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RAB8A Antibody

  • mel transforming oncogene (derived from cell line NK14)- RAB8 homolog
  • mel transforming oncogene (derived from cell line NK14)
  • MELras-associated protein RAB8
  • Oncogene c-mel
  • RAB8A, member RAS oncogene family
  • RAB8mel transforming oncogene (RAB8 homolog)
  • ras-related protein Rab-8A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02142
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84682
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-92307
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00005873-M02
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
H00117177-B01P
Species: Hu, Ze
Applications: WB, ChIP, ELISA
NB120-3335
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IP
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP2-57641
Species: Hu
Applications: WB, ICC/IF
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP1-47492
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-14081
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RAB8A Antibody (NBP1-79960) (0)

There are no publications for RAB8A Antibody (NBP1-79960).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB8A Antibody (NBP1-79960) (0)

There are no reviews for RAB8A Antibody (NBP1-79960). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB8A Antibody (NBP1-79960) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RAB8A Antibody (NBP1-79960)

Discover related pathways, diseases and genes to RAB8A Antibody (NBP1-79960). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB8A Antibody (NBP1-79960)

Discover more about diseases related to RAB8A Antibody (NBP1-79960).
 

Pathways for RAB8A Antibody (NBP1-79960)

View related products by pathway.

PTMs for RAB8A Antibody (NBP1-79960)

Learn more about PTMs related to RAB8A Antibody (NBP1-79960).

Blogs on RAB8A

There are no specific blogs for RAB8A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB8A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB8A
Uniprot