Rab27a Antibody (1G7)

Images

 
Western Blot: Rab27a Antibody (1G7) [H00005873-M02] - RAB27A monoclonal antibody (M02), clone 1G7 Analysis of RAB27A expression in HL-60.
Immunohistochemistry-Paraffin: Rab27a Antibody (1G7) [H00005873-M02] - Analysis of monoclonal antibody to RAB27A on formalin-fixed paraffin-embedded human lymphoma. Antibody concentration 3 ug/ml.
Western Blot: Rab27a Antibody (1G7) [H00005873-M02] - Analysis of RAB27A over-expressed 293 cell line, cotransfected with RAB27A Validated Chimera RNAi ( Cat # H00005873-R01V ) (Lane 2) or non-transfected control (Lane ...read more
Western Blot: Rab27a Antibody (1G7) [H00005873-M02] - Analysis of RAB27A expression in transfected 293T cell line by RAB27A monoclonal antibody (M02), clone 1G7.Lane 1: RAB27A transfected lysate(24.9 KDa).Lane 2: ...read more
Sandwich ELISA: Rab27a Antibody (1G7) [H00005873-M02] - Detection limit for recombinant GST tagged RAB27A is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P, RNAi
Clone
1G7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Rab27a Antibody (1G7) Summary

Immunogen
RAB27A (NP_004571, 122 a.a. - 221 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC
Specificity
RAB27A - RAB27A, member RAS oncogene family
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RAB27A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
  • RNA Inhibition
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P, RNAi Validation and ELISA.
Positive Control
Rab27a Lysate (NBP2-65045)
Publications
Read Publications using
H00005873-M02 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Rab27a Antibody (1G7)

  • GS2
  • GS2rab-27
  • GTP-binding protein Ram
  • HsT18676
  • Rab-27
  • Rab27a
  • RAB27A, member RAS oncogene family
  • RAB27MGC117246
  • RAM
  • RAMras-related protein Rab-27A

Background

The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations in this gene are associated with Griscelli syndrome type 2. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NB300-943
Species: Mu
Applications: WB, ICC/IF, IHC-P, PEP-ELISA
NBP1-92156
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-00487
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-89538
Species: Hu
Applications: WB, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-41385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-86176
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1278
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB120-3335
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IP
NBP1-84764
Species: Hu
Applications: IHC, IHC-P
NBP1-80991
Species: Hu
Applications: IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00004218-M02
Species: Hu, Ze
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for Rab27a Antibody (H00005873-M02)(12)

We have publications tested in 2 confirmed species: Human, Rabbit.

We have publications tested in 3 applications: ICC/IF, IHC-P, WB.


Filter By Application
ICC/IF
(1)
IHC-P
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Rabbit
(1)
All Species
Showing Publications 1 - 10 of 12. Show All 12 Publications.
Publications using H00005873-M02 Applications Species
Felicetti F, De Feo A, Coscia C et al. Exosome-mediated transfer of miR-222 is sufficient to increase tumor malignancy in melanoma. J Transl Med 2016 Feb 24 [PMID: 26912358]
Fang Y, Garnier D, Lee TH et al. PML-RARa modulates the vascular signature of extracellular vesicles released by acute promyelocytic leukemia cells. Angiogenesis. 2015 Sep 15 [PMID: 26374632]
Chen TC, Hsieh CH, Sarnow P. Supporting Role for GTPase Rab27a in Hepatitis C Virus RNA Replication through a Novel miR-122-Mediated Effect. PLoS Pathog. 2015 Aug 25 [PMID: 26305877]
Hannafon BN, Carpenter KJ, Berry WL et al. Exosome-mediated microRNA signaling from breast cancer cells is altered by the anti-angiogenesis agent docosahexaenoic acid (DHA). Mol Cancer. 2015 Jul 16 [PMID: 26178901]
Cetica V, Hackmann Y, Grieve S et al. Patients with Griscelli syndrome and normal pigmentation identify RAB27A mutations that selectively disrupt MUNC13-4 binding. J Allergy Clin Immunol. 2014 Oct 10 [PMID: 25312756]
Kimura T, Yamaoka M, Taniguchi S et al. Activated Cdc42-Bound IQGAP1 Determines the Cellular Endocytic Site. Mol Cell Biol. 2013 Oct 07 [PMID: 24100016]
Peinado H, Aleckovic M, Lavotshkin S et al. Melanoma exosomes educate bone marrow progenitor cells toward a pro-metastatic phenotype through MET. Nat Med. 2012 May 27 [PMID: 22635005]
Sanchez-Ruiz Y, Valitutti S, Dupre L. Stepwise Maturation of Lytic Granules during Differentiation and Activation of Human CD8+ T Lymphocytes. PLoS One. 2011 Nov 04 [PMID: 22073254]
Chiang L, Ngo J, Schechter J et al. Rab27b regulates exocytosis of secretory vesicles in acinar epithelial cells from the lacrimal gland Am J Physiol Cell Physiol 2011 Aug [PMID: 21525430] (WB, ICC/IF, Rabbit) WB, ICC/IF Rabbit
Neumuller O, Hoffmeister M, Babica J et al. Synaptotagmin-like protein 1 interacts with the GTPase-activating protein Rap1GAP2 and regulates dense granule secretion in platelets. Blood. 2009 Jun 15 [PMID: 19528539]
Show All 12 Publications.

Reviews for Rab27a Antibody (H00005873-M02) (0)

There are no reviews for Rab27a Antibody (H00005873-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rab27a Antibody (H00005873-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Rab27a Antibody (H00005873-M02)

Discover related pathways, diseases and genes to Rab27a Antibody (H00005873-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rab27a Antibody (H00005873-M02)

Discover more about diseases related to Rab27a Antibody (H00005873-M02).
 

Pathways for Rab27a Antibody (H00005873-M02)

View related products by pathway.

PTMs for Rab27a Antibody (H00005873-M02)

Learn more about PTMs related to Rab27a Antibody (H00005873-M02).
 

Research Areas for Rab27a Antibody (H00005873-M02)

Find related products by research area.

Blogs on Rab27a

There are no specific blogs for Rab27a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rab27a Antibody (1G7) and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB27A
Entrez
OMIM
Uniprot