RAB8B Antibody

Images

 
Western Blot: RAB8B Antibody [NBP2-57641] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: RAB8B Antibody [NBP2-57641] - Staining of human cell line RH-30 shows localization to nucleoplasm & vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAB8B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL
Specificity
Specificity of human RAB8B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB8B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RAB8B Antibody

  • FLJ38125
  • RAB-8b protein
  • RAB8B, member RAS oncogene family
  • ras-related protein Rab-8B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004218-M02
Species: Hu, Ze
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-45499
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45883
Species: Hu
Applications: WB, IHC
NBP1-80991
Species: Hu
Applications: IHC, IHC-P
NBP1-92307
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-46574
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005873-M02
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP2-31896
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-87940
Species: Hu
Applications: IHC, IHC-P
NBP1-87185
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RAB8B Antibody (NBP2-57641) (0)

There are no publications for RAB8B Antibody (NBP2-57641).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB8B Antibody (NBP2-57641) (0)

There are no reviews for RAB8B Antibody (NBP2-57641). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAB8B Antibody (NBP2-57641) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RAB8B Products

Bioinformatics Tool for RAB8B Antibody (NBP2-57641)

Discover related pathways, diseases and genes to RAB8B Antibody (NBP2-57641). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB8B Antibody (NBP2-57641)

Discover more about diseases related to RAB8B Antibody (NBP2-57641).
 

Pathways for RAB8B Antibody (NBP2-57641)

View related products by pathway.

PTMs for RAB8B Antibody (NBP2-57641)

Learn more about PTMs related to RAB8B Antibody (NBP2-57641).
 

Research Areas for RAB8B Antibody (NBP2-57641)

Find related products by research area.

Blogs on RAB8B

There are no specific blogs for RAB8B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB8B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB8B