Reactivity | Hu, Mu, Pm, Rt, Bv, Ca, Eq, Gt, Gp, RbSpecies Glossary |
Applications | WB, IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | Synthetic peptides corresponding to RAB1A(RAB1A, member RAS oncogene family) The peptide sequence was selected from the middle region of RAB1A. Peptide sequence AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC. The peptide sequence for this immunogen was taken from within the described region. |
Predicted Species | Rat (100%), Canine (100%), Goat (100%), Equine (100%), Rabbit (100%), Bovine (100%), Guinea Pig (100%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | RAB1A |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | This is a rabbit polyclonal antibody against RAB1A and was validated on Western blot. |
||
Theoretical MW | 23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
Control |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS and 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for Rab1A Antibody (NBP1-55113)Discover more about diseases related to Rab1A Antibody (NBP1-55113).
| Pathways for Rab1A Antibody (NBP1-55113)View related products by pathway.
|
PTMs for Rab1A Antibody (NBP1-55113)Learn more about PTMs related to Rab1A Antibody (NBP1-55113).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.