Rab1A Antibody

Western Blot: Rab1A Antibody [NBP1-55113] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Muscle

Immunohistochemistry: Rab1A Antibody [NBP1-55113] - Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasmic in excellent staining Primary Antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Western Blot: Rab1A Antibody [NBP1-55113] - HeLa, Vera, HeLa transfected with mouse construct, Antibody Titration: 0.2-1 ug/ml

Western Blot: Rab1A Antibody [NBP1-55113] - Sample Tissue: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 12%

Western Blot: Rab1A Antibody [NBP1-55113] - 1. Human Cervical Cancer Cell lysate (15ug) 2. Monkey Fibroblast Cell lysate (15ug) 3. Human Cervical Cancer Cell transfected with Rab1A-GFP (15ug) Primary Dilution: 1 : 1000 Secondary Antibody: goat anti-Rabbit Secondary Dilution: 1 : 40,000.

Western Blot: Rab1A Antibody [NBP1-55113] - 293T Whole Cell lysates, Antibody Dilution: 0.2 ug/ml.

Western Blot: Rab1A Antibody [NBP1-55113] - Analysis of HepG2 cell lysate. Antibody Dilution: 1.0 ug/ml.

• Reactivity: Hu, Mu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Rab1A Antibody Summary

• Immunogen: Synthetic peptides corresponding to RAB1A(RAB1A, member RAS oncogene family) The peptide sequence was selected from the middle region of RAB1A. Peptide sequence AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAB1A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:100
• Application Notes: This is a rabbit polyclonal antibody against RAB1A and was validated on Western blot.
• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control:

  Rab1A Lysate (NBP2-65793)

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Rab1A Antibody

• DKFZp564B163
• member RAS oncogene family
• RAB1A, member RAS oncogene family
• ras-related protein Rab-1A

Background

This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms. This small GTPase controls vesicle traffic from the endoplasmic reticulum to the Golgi apparatus. Multipl

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAB1A
• Uniprot:
  • P62820(Human)