Rab1A Antibody

Images

 
Western Blot: Rab1A Antibody [NBP1-55113] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Muscle
Immunohistochemistry: Rab1A Antibody [NBP1-55113] - Formalin Fixed Paraffin Embedded Human Bronchial Epithelial Tissue. Observed Staining: Cytoplasmic staining with Primary Antibody Concentration: 1:100 Secondary ...read more
Western Blot: Rab1A Antibody [NBP1-55113] - HeLa, Vera, HeLa transfected with mouse construct, Antibody Titration: 0.2-1 ug/ml
Western Blot: Rab1A Antibody [NBP1-55113] - Sample Tissue: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate ...read more
Western Blot: Rab1A Antibody [NBP1-55113] - 1. Human Cervical Cancer Cell lysate (15ug) 2. Monkey Fibroblast Cell lysate (15ug) 3. Human Cervical Cancer Cell transfected with Rab1A-GFP (15ug) Primary Dilution: 1 : 1000 ...read more
Western Blot: Rab1A Antibody [NBP1-55113] - 293T Whole Cell lysates, Antibody Dilution: 0.2 ug/ml.
Western Blot: Rab1A Antibody [NBP1-55113] - Analysis of HepG2 cell lysate. Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, PmSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

Rab1A Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to RAB1A(RAB1A, member RAS oncogene family) The peptide sequence was selected from the middle region of RAB1A. Peptide sequence AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB1A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:100
  • Western Blot 1.0 ug/ml
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for Rab1A Antibody

  • DKFZp564B163
  • member RAS oncogene family
  • RAB1
  • Rab1A
  • RAB1A, member RAS oncogene family
  • ras-related protein Rab-1A

Background

This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms. This small GTPase controls vesicle traffic from the endoplasmic reticulum to the Golgi apparatus. Multipl

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Rab1A Antibody (NBP1-55113) (0)

There are no publications for Rab1A Antibody (NBP1-55113).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rab1A Antibody (NBP1-55113) (0)

There are no reviews for Rab1A Antibody (NBP1-55113). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rab1A Antibody (NBP1-55113) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Rab1A Products

Research Areas for Rab1A Antibody (NBP1-55113)

Find related products by research area.

Blogs on Rab1A

There are no specific blogs for Rab1A, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rab1A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB1A
Uniprot