PUM1 Antibody

Images

 
Independent Antibodies: Western Blot: PUM1 Antibody [NBP1-87856] - Analysis using Anti-PUM1 antibody NBP1-87856 (A) shows similar pattern to independent antibody NBP2-58337 (B).
Immunocytochemistry/ Immunofluorescence: PUM1 Antibody [NBP1-87856] - Staining of human cell line U-251 MG shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: PUM1 Antibody [NBP1-87856] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Western Blot: PUM1 Antibody [NBP1-87856] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

PUM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CLRKGGFGPRDADSDENDKGEKKNKGTFDGDKLGDLKEEGDVMDKTNGLPVQNGIDADVKDFSRTPGNCQNSANEVDLLGPN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PUM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PUM1 Protein (NBP1-87856PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PUM1 Antibody

  • HSPUM
  • KIAA0099PUML1
  • PUM1
  • PUMH
  • PUMH1
  • PUMH1pumilio homolog 1
  • pumilio (Drosophila) homolog 1
  • pumilio homolog 1 (Drosophila)
  • Pumilio-1
  • PUML1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-387
Species: Hu, Mu, Rt
Applications: IP, WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
H00004831-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
NB600-501
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB600-533
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IP, Simple Western, WB
NB500-317
Species: Bv(-), Ca(-), Ch(-), Hu, Mu(-), Rb(-)
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA, WB
NBP2-97473
Species: Hu
Applications: IHC-P, IP, WB
H00003429-A01
Species: Hu
Applications: ELISA, IHC, IHC-Fr, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NB100-1437
Species: Hu
Applications: PEP-ELISA, WB
NBP1-87511
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80851
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-88000
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-47561
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-30993
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-33527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DRB400
Species: Hu
Applications: ELISA

Publications for PUM1 Antibody (NBP1-87856) (0)

There are no publications for PUM1 Antibody (NBP1-87856).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PUM1 Antibody (NBP1-87856) (0)

There are no reviews for PUM1 Antibody (NBP1-87856). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PUM1 Antibody (NBP1-87856) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PUM1 Products

Bioinformatics Tool for PUM1 Antibody (NBP1-87856)

Discover related pathways, diseases and genes to PUM1 Antibody (NBP1-87856). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PUM1 Antibody (NBP1-87856)

Discover more about diseases related to PUM1 Antibody (NBP1-87856).
 

Pathways for PUM1 Antibody (NBP1-87856)

View related products by pathway.

PTMs for PUM1 Antibody (NBP1-87856)

Learn more about PTMs related to PUM1 Antibody (NBP1-87856).
 

Research Areas for PUM1 Antibody (NBP1-87856)

Find related products by research area.

Blogs on PUM1

There are no specific blogs for PUM1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PUM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PUM1