PUM1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit PUM1 Antibody - BSA Free (NBP1-87856) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: CLRKGGFGPRDADSDENDKGEKKNKGTFDGDKLGDLKEEGDVMDKTNGLPVQNGIDADVKDFSRTPGNCQNSANEVDLLGPN |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PUM1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PUM1 Antibody - BSA Free
Background
Pumilio-1 encodes a member of the PUF family, evolutionarily conserved RNA-binding proteins related to the Pumilio proteins of Drosophila and the fem-3 mRNA binding factor proteins of C. elegans. The encoded protein contains a sequence-specific RNA binding domain comprised of eight repeats and N- and C-terminal flanking regions, and serves as a translational regulator of specific mRNAs by binding to their 3' untranslated regions. The evolutionarily conserved function of the encoded protein in invertebrates and lower vertebrates suggests that the human protein may be involved in translational regulation of embryogenesis, and cell development and differentiation. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IP, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gt, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IP, Simple Western, WB
Species: Bv(-), Ca(-), Ch(-), Hu, Mu(-), Rb(-)
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA, WB
Species: Hu
Applications: IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: ELISA
Publications for PUM1 Antibody (NBP1-87856) (0)
There are no publications for PUM1 Antibody (NBP1-87856).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PUM1 Antibody (NBP1-87856) (0)
There are no reviews for PUM1 Antibody (NBP1-87856).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PUM1 Antibody (NBP1-87856) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PUM1 Products
Research Areas for PUM1 Antibody (NBP1-87856)
Find related products by research area.
|
Blogs on PUM1