beta-Glucuronidase/GUSB Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: beta-Glucuronidase/GUSB Antibody [NBP1-87511] - Analysis in human liver and skeletal muscle tissues using NBP1-87511 antibody. Corresponding GUSB RNA-seq data ...read more
Western Blot: beta-Glucuronidase/GUSB Antibody [NBP1-87511] - Analysis in control (vector only transfected HEK293T lysate) and GUSB over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in ...read more
Immunocytochemistry/ Immunofluorescence: beta-Glucuronidase/GUSB Antibody [NBP1-87511] - staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: beta-Glucuronidase/GUSB Antibody [NBP1-87511] - Staining of human Liver shows strong positivity in lysosomes in hepatocytes.
Immunohistochemistry-Paraffin: beta-Glucuronidase/GUSB Antibody [NBP1-87511] - Staining of human liver shows strong positivity in lysosomes in hepatocytes.
Immunohistochemistry-Paraffin: beta-Glucuronidase/GUSB Antibody [NBP1-87511] - Staining of human endometrium shows strong postivity in lysosomes in glandular cells.
Immunohistochemistry-Paraffin: beta-Glucuronidase/GUSB Antibody [NBP1-87511] - Staining of human prostate shows positivity in lysosomes in glandular cells.
Immunohistochemistry-Paraffin: beta-Glucuronidase/GUSB Antibody [NBP1-87511] - Staining of human skeletal muscle shows very weak positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

beta-Glucuronidase/GUSB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GYLPFEADISNLVQVGPLPSRLRITIAINNTLTPTTLPPGTIQYLTDTSKYPKGYFVQNTYFDFFNYAGLQRSVLLYTTPTTYIDDITVTTS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GUSB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 1:100-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
75 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
beta-Glucuronidase/GUSB Protein (NBP1-87511PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for beta-Glucuronidase/GUSB Antibody

  • beta-D-glucuronidase
  • Beta-G1
  • beta-glucuronidase
  • BG
  • EC 3.2.1.31
  • FLJ39445
  • glucuronidase, beta
  • GUSB
  • MPS7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NBP2-34260
Species: Bv, Hu, Mu, Po, Rb
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-61118
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
H00347527-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-24916
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF3667
Species: Hu, Mu
Applications: ICC, IHC, Simple Western, WB
AF1029
Species: Mu
Applications: ICC, IHC, IP, WB
NB600-41532
Species: Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
664-LI/CF
Species: Hu
Applications: BA
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NB100-56473
Species: Hu, Mu, Pm
Applications: Simple Western, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-19465
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
NBP1-87511
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for beta-Glucuronidase/GUSB Antibody (NBP1-87511) (0)

There are no publications for beta-Glucuronidase/GUSB Antibody (NBP1-87511).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for beta-Glucuronidase/GUSB Antibody (NBP1-87511) (0)

There are no reviews for beta-Glucuronidase/GUSB Antibody (NBP1-87511). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for beta-Glucuronidase/GUSB Antibody (NBP1-87511). (Showing 1 - 1 of 1 FAQ).

  1. I have purchased the anti-beta Glucuronidase antibody NBP1-87511, and would like to know the concentration of the stock. On the datasheet, it is stated that Concentrations vary lot to lot. See vial label for concentration. However, there is no concentration written on the tube label. Can you help me find the concentration of this antibody, batch R34010?
    • I am sorry that the information which you require was not printed on the vial label. Lot R34010 is at a concentration of 0.2mg/ml.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional beta-Glucuronidase/GUSB Products

Bioinformatics Tool for beta-Glucuronidase/GUSB Antibody (NBP1-87511)

Discover related pathways, diseases and genes to beta-Glucuronidase/GUSB Antibody (NBP1-87511). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for beta-Glucuronidase/GUSB Antibody (NBP1-87511)

Discover more about diseases related to beta-Glucuronidase/GUSB Antibody (NBP1-87511).
 

Pathways for beta-Glucuronidase/GUSB Antibody (NBP1-87511)

View related products by pathway.

PTMs for beta-Glucuronidase/GUSB Antibody (NBP1-87511)

Learn more about PTMs related to beta-Glucuronidase/GUSB Antibody (NBP1-87511).

Blogs on beta-Glucuronidase/GUSB

There are no specific blogs for beta-Glucuronidase/GUSB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our beta-Glucuronidase/GUSB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GUSB
Entrez
Uniprot