26S proteasome subunit 9 Antibody


Western Blot: 26S proteasome subunit 9 Antibody [NBP2-47561] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human plasma (IgG/HSA ...read more
Immunocytochemistry/ Immunofluorescence: 26S proteasome subunit 9 Antibody [NBP2-47561] - Staining of human cell line A-431 shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561] - Staining of human skin using Anti-PSMD9 antibody.
Independent Antibodies: Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561] - Staining of human kidney, liver, skin and testis using Anti-PSMD9 antibody NBP2-47561 (A) shows similar ...read more
Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561] - Staining of human kidney using Anti-PSMD9 antibody.
Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561] - Staining of human liver using Anti-PSMD9 antibody.
Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561] - Staining of human testis using Anti-PSMD9 antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Independent Antibodies


Order Details

26S proteasome subunit 9 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: SDEEARQSGGSSQAGAVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVR
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
26S proteasome subunit 9 Protein (NBP2-47561PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (83%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for 26S proteasome subunit 9 Antibody

  • 26S proteasome non-ATPase regulatory subunit 9
  • p27
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 9
  • Rpn4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Bv, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB

Publications for 26S proteasome subunit 9 Antibody (NBP2-47561) (0)

There are no publications for 26S proteasome subunit 9 Antibody (NBP2-47561).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 26S proteasome subunit 9 Antibody (NBP2-47561) (0)

There are no reviews for 26S proteasome subunit 9 Antibody (NBP2-47561). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for 26S proteasome subunit 9 Antibody (NBP2-47561) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional 26S proteasome subunit 9 Products

Bioinformatics Tool for 26S proteasome subunit 9 Antibody (NBP2-47561)

Discover related pathways, diseases and genes to 26S proteasome subunit 9 Antibody (NBP2-47561). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 26S proteasome subunit 9 Antibody (NBP2-47561)

Discover more about diseases related to 26S proteasome subunit 9 Antibody (NBP2-47561).

Pathways for 26S proteasome subunit 9 Antibody (NBP2-47561)

View related products by pathway.

Research Areas for 26S proteasome subunit 9 Antibody (NBP2-47561)

Find related products by research area.

Blogs on 26S proteasome subunit 9

There are no specific blogs for 26S proteasome subunit 9, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our 26S proteasome subunit 9 Antibody and receive a gift card or discount.


Gene Symbol PSMD9