NM23-H2/NME2 Antibody (1D3)

Images

 
Western Blot: NM23-H2/NME2 Antibody (1D3) [H00004831-M06] - Analysis of NME2 expression in Raw 264.7 (Cat # L024V1).
Immunocytochemistry/ Immunofluorescence: NM23-H2/NME2 Antibody (1D3) [H00004831-M06] - Analysis of monoclonal antibody to NME2 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: NM23-H2/NME2 Antibody (1D3) [H00004831-M06] - Analysis of monoclonal antibody to NME2 on formalin-fixed paraffin-embedded human testis. Antibody concentration 1.5 ug/ml
Western Blot: NM23-H2/NME2 Antibody (1D3) [H00004831-M06] - Analysis of NME2 expression in HeLa (Cat # L013V1).
Western Blot: NM23-H2/NME2 Antibody (1D3) [H00004831-M06] - Analysis of NME2 expression in PC-12 (Cat # L012V1).
Western Blot: NM23-H2/NME2 Antibody (1D3) [H00004831-M06] - Analysis of NME2 expression in NIH/3T3 (Cat # L018V1).
Sandwich ELISA: NM23-H2/NME2 Antibody (1D3) [H00004831-M06] - Detection limit for recombinant GST tagged NME2 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
1D3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NM23-H2/NME2 Antibody (1D3) Summary

Immunogen
NME2 (NP_002503, 51 a.a. - 152 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Specificity
NME2 (1D3)
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NME2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recominant protein and cell lysate for WB. It has also been used for IF, IHC-P and ELISA.
Control
NM23-H2/NME2 Lysate (NBP2-64882)
Publications
Read Publication using H00004831-M06.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NM23-H2/NME2 Antibody (1D3)

  • EC 2.7.13.3
  • Histidine protein kinase NDKB
  • MGC2212
  • NDK B
  • NDKB
  • NDP Kinase B2
  • NDPKB
  • NDPK-B
  • NM23B
  • NM23-H2
  • NME2
  • non-metastatic cells 2, protein (NM23B) expressed in
  • nucleoside diphosphate kinase B
  • protein (NM23) expressed in

Background

Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants encoding the same isoform have been found for this gene. Co-transcription of this gene and the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) which encode a fusion protein comprised of sequence sharing identity with each individual gene product.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
AF3014
Species: Hu
Applications: WB, IHC, Block
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-02487
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-66228
Species: Hu
NB100-387
Species: Hu, Mu, Rt
Applications: WB, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP2-56908
Species: Hu
Applications: ICC/IF
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-24695
Species: Hu
Applications: WB, IHC-P
NB100-259
Species: Hu, Mu
Applications: WB, GS, IP
H00004831-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for NM23-H2/NME2 Antibody (H00004831-M06)(1)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for NM23-H2/NME2 Antibody (H00004831-M06) (0)

There are no reviews for NM23-H2/NME2 Antibody (H00004831-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NM23-H2/NME2 Antibody (H00004831-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NM23-H2/NME2 Antibody (H00004831-M06)

Discover related pathways, diseases and genes to NM23-H2/NME2 Antibody (H00004831-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NM23-H2/NME2 Antibody (H00004831-M06)

Discover more about diseases related to NM23-H2/NME2 Antibody (H00004831-M06).
 

Pathways for NM23-H2/NME2 Antibody (H00004831-M06)

View related products by pathway.

PTMs for NM23-H2/NME2 Antibody (H00004831-M06)

Learn more about PTMs related to NM23-H2/NME2 Antibody (H00004831-M06).
 

Research Areas for NM23-H2/NME2 Antibody (H00004831-M06)

Find related products by research area.

Blogs on NM23-H2/NME2

There are no specific blogs for NM23-H2/NME2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NM23-H2/NME2 Antibody (1D3) and receive a gift card or discount.

Bioinformatics

Gene Symbol NME2
Entrez
OMIM
Uniprot