SF4 Antibody

Western Blot: SF4 Antibody [NBP1-88000] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.

Immunocytochemistry/Immunofluorescence: SF4 Antibody [NBP1-88000] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: SF4 Antibody [NBP1-88000] - Staining of human Liver shows very weak nuclear positivity in hepatocytes.

Western Blot: SF4 Antibody [NBP1-88000] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Western Blot: SF4 Antibody [NBP1-88000] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: SF4 Antibody [NBP1-88000] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells and glial cells.

Immunohistochemistry-Paraffin: SF4 Antibody [NBP1-88000] - Analysis in human testis and liver tissues using NBP1-88000 antibody. Corresponding SUGP1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SF4 Antibody [NBP1-88000] - Staining of human Cerebral cortex shows strong nuclear positivity in neuronal and glial cells.

Immunohistochemistry-Paraffin: SF4 Antibody [NBP1-88000] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: SF4 Antibody [NBP1-88000] - Staining of human Testis shows strong nuclear positivity in cells in seminiferous ducts and leydig cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SF4 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKMEQKAKQNQVASPQPPHPGEITNAHNSSCISNKFANDGSFLQQFLKLQKAQTSTDAPTSAPSAPPSTPT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SUGP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Knockdown Validated
  • Western Blot 1:100-1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SF4 Protein (NBP1-88000PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SF4 Antibody

• DKFZp434E2216
• F23858
• SF4RNA-binding protein RBP
• Splicing factor 4RBP
• SURP and G patch domain containing 1
• SURP and G-patch domain-containing protein 1

Background

SF4 is a member of the SURP family of splicing factors.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SUGP1