PTP epsilon Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: NGILEEQEQQRVMLLSRSPSGPKKYFPIPVEHLEEEIRIRSADDCKQFREEFNSLPSGHIQGTFELANKEENREKNRYPNILPNDHSRVILSQLDGIPCSDYINASYIDGYKEKNKFIAAQGPKQE |
| Predicted Species |
Mouse (96%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PTPRE |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PTP epsilon Antibody - BSA Free
Background
PTP epsilon, an R4 receptor protein tyrosine phosphatase, is composed of a short extracellular and two cyplasmic protein phosphatase domains and has been shown to affect neuronal differentiation, endothelial cell growth, vascular development, and possibly mammary tumor development. It has been shown that the cytosolic form of PTP epsilon can be induced by IL-1 and TNF alpha in humans and is a negative regulator of IL-6- and LIF-induced Jak-STAT kinase signaling in rats. Four alternatively spliced protein isoforms have been documented for PTP epsilon: a membrane form, a cytosolic form, the p65 form, which results from translation using an internal initiation codon, and the p67 form, which results from a specific proteolytic cleavage of wild-type PTP epsilon. PTP epsilon expression has been documented in human vascular endothelial cells, astrocytoma cells, and in IW32 erythroleukemia overexpressing p53. PTP epsilon expression has been documented in animal brain, breast, ganglion, heart, kidney, liver, lung, nerve, spinal cord, spleen, testis, and vessel. The membrane and cytosolic forms of PTP epsilon show different tissue expression patterns. ESTs have been isolated from numerous human tissue libraries, including normal human blood, brain, testis, and thyroid, and cancerous human blood, brain, breast, colon, embryo, head/neck, pancreas, and skin.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: WB
Species: Mu
Applications: WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, Simple Western, WB
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
Publications for PTP epsilon Antibody (NBP1-87189) (0)
There are no publications for PTP epsilon Antibody (NBP1-87189).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PTP epsilon Antibody (NBP1-87189) (0)
There are no reviews for PTP epsilon Antibody (NBP1-87189).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PTP epsilon Antibody (NBP1-87189) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PTP epsilon Products
Research Areas for PTP epsilon Antibody (NBP1-87189)
Find related products by research area.
|
Blogs on PTP epsilon