KCNB1 Antibody - BSA Free

Immunohistochemistry-Paraffin: KCNB1 Antibody [NBP2-38498] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: KCNB1 Antibody [NBP2-38498] -Staining of human small intestine shows moderate membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: KCNB1 Antibody [NBP2-38498] -Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: KCNB1 Antibody [NBP2-38498] -Staining of human tonsil shows no positivity in non-germinal center cells as expected.

• Reactivity: Hu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KCNB1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KCNB1 Antibody - BSA Free (NBP2-38498) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ECATLLDKAVLSPESSIYTTASAKTPPRSPEKHTAIAFNFEAGVHQYIDADTDDEGQLLYSVDSSPPKSLPGSTSPKFSTGTRSEKNHFESSPLPTSPKFLRQNCIYSTEALTGK
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  KCNB1 Recombinant Protein Antigen (NBP2-38498PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KCNB1 Antibody - BSA Free

• Delayed rectifier potassium channel 1
• delayed rectifier potassium channel Kv2.1
• DRK1
• h-DRK1 K(+) channel
• h-DRK1
• KCNB1
• KV2.1
• potassium channel protein DRK1
• potassium voltage-gated channel subfamily B member 1
• potassium voltage-gated channel, Shab-related subfamily, member 1
• Voltage-gated potassium channel subunit Kv2.1

Background

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shab-related subfamily. This member is a delayed rectifier potassium channel and its activity is modulated by some other family members. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNB1
• Uniprot:
  • Q14721(Human)