SLC25A3 Antibody Summary
Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
Immunogen |
SLC25A3 (NP_002626.1, 1 a.a. - 361 a.a.) full-length human protein. MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEYSCEFGSAKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLTQ |
Specificity |
SLC25A3, |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Mouse |
Gene |
SLC25A3 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/Immunofluorescence
- Western Blot
|
Application Notes |
It has been used for ELISA and WB. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for SLC25A3 Antibody
Background
The protein encoded by this gene catalyzes the transport of phosphate into the mitochondrial matrix, either by proton cotransport or in exchange for hydroxyl ions. The protein contains three related segments arranged in tandem which are related to those found in other characterized members of the mitochondrial carrier family. Both the N-terminal and C-terminal regions of this protein protrude toward the cytosol. Multiple alternatively spliced transcript variants have been isolated. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC, Simple Western, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: WB, ICC/IF
Publications for SLC25A3 Antibody (H00005250-B02P) (0)
There are no publications for SLC25A3 Antibody (H00005250-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SLC25A3 Antibody (H00005250-B02P) (0)
There are no reviews for SLC25A3 Antibody (H00005250-B02P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SLC25A3 Antibody (H00005250-B02P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SLC25A3 Products
Bioinformatics Tool for SLC25A3 Antibody (H00005250-B02P)
Discover related pathways, diseases and genes to SLC25A3 Antibody (H00005250-B02P). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for SLC25A3 Antibody (H00005250-B02P)
Discover more about diseases related to SLC25A3 Antibody (H00005250-B02P).
| | Pathways for SLC25A3 Antibody (H00005250-B02P)
View related products by pathway.
|
Blogs on SLC25A3