SLC25A3 Antibody

Images

 
Western Blot: SLC25A3 Antibody [H00005250-B02P] - Analysis of SLC25A3 expression in human pancreas.
Immunocytochemistry/ Immunofluorescence: SLC25A3 Antibody [H00005250-B02P] - Analysis of purified antibody to SLC25A3 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: SLC25A3 Antibody [H00005250-B02P] - Analysis of SLC25A3 expression in transfected 293T cell line by SLC25A3 polyclonal antibody. Lane 1: SLC25A3 transfected lysate(39.71 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SLC25A3 Antibody Summary

Immunogen
SLC25A3 (NP_002626.1, 1 a.a. - 361 a.a.) full-length human protein. MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEYSCEFGSAKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLTQ
Specificity
SLC25A3,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SLC25A3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC25A3 Antibody

  • PHCmitochondrial phosphate carrier protein
  • phosphate carrier protein, mitochondrial
  • Phosphate transport protein
  • PTP
  • solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3
  • Solute carrier family 25 member 3

Background

The protein encoded by this gene catalyzes the transport of phosphate into the mitochondrial matrix, either by proton cotransport or in exchange for hydroxyl ions. The protein contains three related segments arranged in tandem which are related to those found in other characterized members of the mitochondrial carrier family. Both the N-terminal and C-terminal regions of this protein protrude toward the cytosol. Multiple alternatively spliced transcript variants have been isolated. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1366
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-83276
Species: Hu, Rt, Hu(-)
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-54602
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-42172
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, ICC
NB100-77417
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
MAB1930
Species: Hu, Mu, Rt
Applications: WB
NBP1-87188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow

Publications for SLC25A3 Antibody (H00005250-B02P) (0)

There are no publications for SLC25A3 Antibody (H00005250-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A3 Antibody (H00005250-B02P) (0)

There are no reviews for SLC25A3 Antibody (H00005250-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SLC25A3 Antibody (H00005250-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SLC25A3 Antibody (H00005250-B02P)

Discover related pathways, diseases and genes to SLC25A3 Antibody (H00005250-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A3 Antibody (H00005250-B02P)

Discover more about diseases related to SLC25A3 Antibody (H00005250-B02P).
 

Pathways for SLC25A3 Antibody (H00005250-B02P)

View related products by pathway.

Blogs on SLC25A3

There are no specific blogs for SLC25A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC25A3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A3
Entrez
Uniprot