PSTPIP1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: GMIKRFSGLLHGSPKTTSLAASAASTETLTPTPERNEGVYTAIAVQEIQGNPASPAQEYRALYDYTAQNPDELDLSAGDILEVILEGEDGWWTVERNGQRGFVPGSYLEK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PSTPIP1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (80%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PSTPIP1 Antibody - BSA Free
Background
The protein encoded by the PSTPIP1 gene binds to the cytoplasmic tail of CD2, an effector of T cell activation and adhesion, negatively affecting CD2-triggered T cell activation. The encoded protein appears to be a scaffold protein and a regulator of the actin cytoskeleton. It has also been shown to bind ABL1, PTPN18, WAS, CD2AP, and PTPN12. Mutations in this gene are a cause of PAPA syndrome. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
Species: Hu
Applications: BA
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IM, IP, Simple Western, WB
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Publications for PSTPIP1 Antibody (NBP1-85764) (0)
There are no publications for PSTPIP1 Antibody (NBP1-85764).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PSTPIP1 Antibody (NBP1-85764) (0)
There are no reviews for PSTPIP1 Antibody (NBP1-85764).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PSTPIP1 Antibody (NBP1-85764) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PSTPIP1 Products
Research Areas for PSTPIP1 Antibody (NBP1-85764)
Find related products by research area.
|
Blogs on PSTPIP1