MVK Antibody (2C5)

Images

 
Western Blot: MVK Antibody (2C5) [H00004598-M02] - Analysis of MVK expression in transfected 293T cell line by MVK monoclonal antibody (M02), clone 2C5.Lane 1: MVK transfected lysate(42.451 KDa).Lane 2: Non-transfected ...read more
Immunohistochemistry-Paraffin: MVK Antibody (2C5) [H00004598-M02] - Analysis of monoclonal antibody to MVK on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.
Sandwich ELISA: MVK Antibody (2C5) [H00004598-M02] - Detection limit for recombinant GST tagged MVK is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
2C5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MVK Antibody (2C5) Summary

Immunogen
MVK (AAH16140 297 a.a. - 396 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LIDMNQHHLNALGVGHASLDQLCQVTRARGLHSKLTGAGGGGCGITLLKPGLEQPEVEATKQALTSCGFDCLETSIGAPGVSIHSATSLDSRVQQALDGL
Specificity
MVK - mevalonate kinase (mevalonic aciduria) (2C5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MVK
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MVK Antibody (2C5)

  • EC 2.7.1.36
  • LH receptor mRNA-binding protein
  • LRBP
  • mevalonate kinase (mevalonic aciduria)
  • mevalonate kinase 1
  • mevalonate kinase
  • Mevalonic Aciduria
  • MKFLJ96772
  • MVK
  • MVLK
  • POROK3

Background

This gene encodes the peroxisomal enzyme mevalonate kinase. Mevalonate is a key intermediate, and mevalonate kinase a key early enzyme, in isoprenoid and sterol synthesis. Mevalonate kinase deficiency caused by mutation of this gene results in mevalonic aciduria, a disease characterized psychomotor retardation, failure to thrive, hepatosplenomegaly, anemia and recurrent febrile crises. Defects in this gene also cause hyperimmunoglobulinaemia D and periodic fever syndrome, a disorder characterized by recurrent episodes of fever associated with lymphadenopathy, arthralgia, gastrointestinal dismay and skin rash. Two transcript variants that encode the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-258-PB
Species: Hu
Applications: WB, Simple Western, IHC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83142
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-17262
Species: Hu
Applications: WB, ICC/IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA

Publications for MVK Antibody (H00004598-M02) (0)

There are no publications for MVK Antibody (H00004598-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MVK Antibody (H00004598-M02) (0)

There are no reviews for MVK Antibody (H00004598-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MVK Antibody (H00004598-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MVK Products

Bioinformatics Tool for MVK Antibody (H00004598-M02)

Discover related pathways, diseases and genes to MVK Antibody (H00004598-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MVK Antibody (H00004598-M02)

Discover more about diseases related to MVK Antibody (H00004598-M02).
 

Pathways for MVK Antibody (H00004598-M02)

View related products by pathway.

PTMs for MVK Antibody (H00004598-M02)

Learn more about PTMs related to MVK Antibody (H00004598-M02).

Blogs on MVK

There are no specific blogs for MVK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MVK Antibody (2C5) and receive a gift card or discount.

Bioinformatics

Gene Symbol MVK
Entrez
Uniprot