PSTPIP2 Antibody


Western Blot: PSTPIP2 Antibody [NBP1-85846] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: PSTPIP2 Antibody [NBP1-85846] - Staining in human spleen and cerebral cortex tissues using anti-PSTPIP2 antibody. Corresponding PSTPIP2 RNA-seq data are presented for the same tissues.
Western Blot: PSTPIP2 Antibody [NBP1-85846] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: PSTPIP2 Antibody [NBP1-85846] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: PSTPIP2 Antibody [NBP1-85846] - Staining of human spleen shows high expression.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

PSTPIP2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LVNPKQQEKLFVKLATSKTAVEDSDKAYMLHIGTLDKVREEWQSEHIKACEAFEAQECERINFFRNALWLHVNQLSQQC
Specificity of human, mouse, rat PSTPIP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PSTPIP2 Protein (NBP1-85846PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (89%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PSTPIP2 Antibody

  • MAYP
  • MGC34175
  • PEST phosphatase-interacting protein 2
  • proline-serine-threonine phosphatase interacting protein 2
  • proline-serine-threonine phosphatase-interacting protein 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, Flow, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PSTPIP2 Antibody (NBP1-85846) (0)

There are no publications for PSTPIP2 Antibody (NBP1-85846).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSTPIP2 Antibody (NBP1-85846) (0)

There are no reviews for PSTPIP2 Antibody (NBP1-85846). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PSTPIP2 Antibody (NBP1-85846) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PSTPIP2 Products

Bioinformatics Tool for PSTPIP2 Antibody (NBP1-85846)

Discover related pathways, diseases and genes to PSTPIP2 Antibody (NBP1-85846). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSTPIP2 Antibody (NBP1-85846)

Discover more about diseases related to PSTPIP2 Antibody (NBP1-85846).

Pathways for PSTPIP2 Antibody (NBP1-85846)

View related products by pathway.

PTMs for PSTPIP2 Antibody (NBP1-85846)

Learn more about PTMs related to PSTPIP2 Antibody (NBP1-85846).

Research Areas for PSTPIP2 Antibody (NBP1-85846)

Find related products by research area.

Blogs on PSTPIP2

There are no specific blogs for PSTPIP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PSTPIP2 Antibody and receive a gift card or discount.


Gene Symbol PSTPIP2