PSAP Antibody - BSA Free

Immunohistochemistry-Paraffin: PSAP Antibody [NBP1-83363] - Staining in human cerebral cortex and skeletal muscle tissues using NBP1-83363 antibody. Corresponding PSAP RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: PSAP Antibody [NBP1-83363] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PSAP Antibody [NBP1-83363] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: PSAP Antibody [NBP1-83363] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: PSAP Antibody [NBP1-83363] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PSAP Antibody [NBP1-83363] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.

Analysis in human cell lines SK-MEL-30 and HEK293 using Anti-PSAP antibody. Corresponding PSAP RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PSAP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSAP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PSAP Protein (NBP1-83363PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PSAP Antibody - BSA Free

• FLJ00245
• GLBA
• proactivator polypeptide
• prosaposin
• PSAP
• SAP1
• SAP1MGC110993
• sphingolipid activator protein-1

Background

PSAP is a highly conserved glycoprotein which is a precursor for 4 cleavage products: saposins A, B, C, and D, which are similar to each other and are sphingolipid hydrolase activator proteins. Each domain of the precursor protein is approximately 80 amino acid residues long with nearly identical placement of cysteine residues and glycosylation sites. Saposins A-D localize primarily to the lysosomal compartment where they facilitate the catabolism of glycosphingolipids with short oligosaccharide groups. The precursor protein exists both as a secretory protein and as an integral membrane protein and has neurotrophic activities. Mutations in PSAP gene have been associated with Gaucher disease, Tay-Sachs disease, and metachromatic leukodystrophy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSAP