ELK4 Antibody

Images

 
Western Blot: ELK4 Antibody [NBP1-87092] - Analysis in control (vector only transfected HEK293T lysate) and ELK4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: ELK4 Antibody [NBP1-87092] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ELK4 Antibody [NBP1-87092] - Staining of human testis shows strong nuclear positivity in Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ELK4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MDPMTVGRIEGDCESLNFSEVSSSSKDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAATISIGPS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ELK4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ELK4 Protein (NBP1-87092PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ELK4 Antibody

  • ELK4, ETS-domain protein (SRF accessory protein 1)
  • ETS-domain protein
  • SAP-1
  • SAP1ETS domain-containing protein Elk-4
  • Serum response factor accessory protein 1
  • SRF accessory protein 1

Background

ELK4 is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is phosphorylated by the kinases, MAPK1 and MAPK8. Several transcript variants have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01264
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-13785
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
NBP2-84128
Species: Hu
Applications: WB
NBP2-38278
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38278
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF2558
Species: Hu, Mu
Applications: Simple Western, WB
H00004068-M01
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
AF8520
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-93766
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-89679
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00001958-M03
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-47289
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86134
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-87092
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ELK4 Antibody (NBP1-87092) (0)

There are no publications for ELK4 Antibody (NBP1-87092).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELK4 Antibody (NBP1-87092) (0)

There are no reviews for ELK4 Antibody (NBP1-87092). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ELK4 Antibody (NBP1-87092) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ELK4 Products

Bioinformatics Tool for ELK4 Antibody (NBP1-87092)

Discover related pathways, diseases and genes to ELK4 Antibody (NBP1-87092). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ELK4 Antibody (NBP1-87092)

Discover more about diseases related to ELK4 Antibody (NBP1-87092).
 

Pathways for ELK4 Antibody (NBP1-87092)

View related products by pathway.

PTMs for ELK4 Antibody (NBP1-87092)

Learn more about PTMs related to ELK4 Antibody (NBP1-87092).

Blogs on ELK4

There are no specific blogs for ELK4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ELK4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ELK4