PPAR alpha/NR1C1 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: PPAR alpha/NR1C1 Antibody [NBP2-58507] - Staining of human cell line A-431 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

PPAR alpha/NR1C1 Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKN
Predicted Species
Mouse (91%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPARA
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PPAR alpha/NR1C1 Recombinant Protein Antigen (NBP2-58507PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PPAR alpha/NR1C1 Antibody - BSA Free

  • alpha
  • hPPAR
  • NR1C1
  • NR1C1MGC2237
  • Nuclear receptor subfamily 1 group C member 1
  • peroxisome proliferator-activated receptor alpha
  • PPAR alpha
  • PPARA
  • PPARalpha
  • PPAR-alpha
  • PPARMGC2452

Background

Peroxisome proliferators are non-genotoxic carcinogens which are purported to exert their effect on cells through their interaction with members of the nuclear hormone receptor family, termed peroxisome proliferator activated receptors (PPARs). Nuclear hormone receptors are ligand-dependent intracellular proteins that stimulate transcription of specific genes by binding to specific DNA sequences following activation by the appropriate ligand. Studies indicate that PPARs are activated by peroxisome proliferators such as clofibric acid, nafenopin, and WY-14,643, as well as by some fatty acids. It has also been shown that PPARs can induce transcription of acyl coenzyme A oxidase & cytochrome P450 A6 (CYP450 A6) through interaction with specific response elements. PPAR alpha is activated by free fatty acids including linoleic, arachidonic, and oleic acids. Induction of peroxisomes by this mechanism leads to a reduction in blood triglyceride levels. PPAR alpha is expressed mainly in skeletal muscle, heart, liver, and kidney and is thought to regulate many genes involved in the beta-oxidation of fatty acids. Activation of rat liver PPAR alpha has been shown to suppress hepatocyte apoptosis. PPAR alpha, like several other nuclear hormone receptors, heterodimerizes with retinoic X receptor (RXR) alpha to form a transcriptionally competent complex. The corresponding gene for the PPAR alpha is NR1C1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB600-637
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
DRP300
Species: Hu
Applications: ELISA
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
NB600-582
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
DLP00
Species: Hu
Applications: ELISA
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB400-144
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
PP-N4111-00
Species: Hu
Applications: IHC, IP, WB
NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for PPAR alpha/NR1C1 Antibody (NBP2-58507) (0)

There are no publications for PPAR alpha/NR1C1 Antibody (NBP2-58507).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPAR alpha/NR1C1 Antibody (NBP2-58507) (0)

There are no reviews for PPAR alpha/NR1C1 Antibody (NBP2-58507). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PPAR alpha/NR1C1 Antibody (NBP2-58507). (Showing 1 - 1 of 1 FAQ).

  1. Please differentiate to me between PPAR and PGC clearly. I am confused with the difference between these two
    • Thank you very much for contacting Novus Biologicals technical support team and sharing your query on the differences between PGC-1 alpha and PPAR. These are two different proteins encoded by their respective genes and serves different functions. PGC-1 alpha (PGC1A or PPAR gamma coactivator 1-alpha) is a transcriptional co-activator for steroid receptors and nuclear receptors, and it regulates diverse aspects of cellular physiology. It up-regulates the transcriptional activity of PPAR-gamma /thyroid hormone receptor on the uncoupling protein promoter; regulates the key mitochondrial genes involved in adaptive thermogenesis; implicates in the metabolic reprogramming in response to nutrients availability through the coordination of the expression of a wide array of genes involved in the regulation of glucose and fatty acid metabolism. Among our PGC-1 alpha antibodies, NBP1-04676 is our best selling product with nice customer feedback and citations in at least 13 research publications. PPAR (PPAR alpha) on the other hand is a ligand-activated transcription factor which gets activated by the endogenous ligand 1-palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine, and oleylethanolamide (a naturally occurring lipid that regulates satiety), and acts as a key regulator of lipid metabolism. It also acts as a receptor for peroxisome proliferators such as hypolipidemic drugs and fatty acids. It regulates the peroxisomal beta-oxidation pathway of fatty acids, and also functions as transcription activator for the ACOX1 and P450 genes. We have a variety of PPAR alpha antibodies. I hope you will find this information helpful but please let me know if I can support you with anything else from my end. Thank you very much for choosing Novus Biologicals as your quality reagent supplier and we wish you the best with your research projects.

Secondary Antibodies

 

Isotype Controls

Additional PPAR alpha/NR1C1 Products

Research Areas for PPAR alpha/NR1C1 Antibody (NBP2-58507)

Find related products by research area.

Blogs on PPAR alpha/NR1C1

There are no specific blogs for PPAR alpha/NR1C1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPAR alpha/NR1C1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol PPARA