POLR1A Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: POLR1A Antibody [NBP2-56122] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

POLR1A Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DEVRGKWQDAHLGKDQRDFNMIDLKFKEEVNHYSNEINKACMPFGLHRQFPENSLQMMVQSGAKGSTVNTMQISCLLGQIELEGR
• Predicted Species: Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POLR1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  POLR1A Recombinant Protein Antigen (NBP2-56122PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for POLR1A Antibody - BSA Free

• DNA-directed RNA polymerase I subunit RPA1
• A190
• POLR1A
• polymerase (RNA) I polypeptide A, 194kDa
• RPA1
• RPA194
• RPO14
• RPO1-4

Background

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Largest and catalytic core component of RNA polymerase I which synthesizes ribosomal RNA precursors. Forms the polymerase active center together with the second largest subunit. A single stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol I. A bridging helix emanates from RPA1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol I by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for POLR1A Antibody (NBP2-56122)(4)

Publications using NBP2-56122

• Sun YM, Zhu SX, Chen XT, Pan Q et Al. lncRNAs maintain the functional phase state of nucleolar prion-like protein to facilitate rRNA processing Mol Cell 2024-11-23 [PMID: 39579766]
• Jaberi-Lashkari N, Lee B, Aryan F, Calo E. An evolutionarily nascent architecture underlying the formation and emergence of biomolecular condensates Cell Reports 2023-08-29 [PMID: 37586369] (Immunocytochemistry/ Immunofluorescence, Frog - Xenopus (African Clawed Frog))
• Lee B, Jaberi-Lashkari N, Calo E. A unified view of low complexity regions (LCRs) across species eLife 2022-09-13 [PMID: 36098382] (Immunocytochemistry/ Immunofluorescence, Frog - Xenopus (African Clawed Frog))
• Kitaoka M, Smith OK, Straight AF, Heald R Molecular conflicts disrupting centromere maintenance contribute to Xenopus hybrid inviability Current biology : CB 2022-08-06 [PMID: 35973429] (ICC/IF, Xenopus)
  
  Details:
  X. laevis and X. tropicalis; Dilutions: 1:500

Bioinformatics

• Gene Symbol: POLR1A