MMAB Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MMAB Antibody [NBP1-86602] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.

Immunohistochemistry-Paraffin: MMAB Antibody [NBP1-86602] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: MMAB Antibody [NBP1-86602] - Staining of human prostate shows strong granular cytoplasmic psotivity in glandular cells.

Immunohistochemistry-Paraffin: MMAB Antibody [NBP1-86602] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.

Analysis in human cell line MCF-7 and human cell line U-2 OS.

Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Knockdown of MMAB increases LDLR expression and activity and decreases cholesterol biosynthesis in vitro.a Representative images of DiI-LDL uptake in Huh7 cells transfected with a non-silencing siRNA (NS) or siRNA MMAB (siMMAB) and incubated with 30 μg/ml DiI-LDL for 8 h at 37 C. Red, DiI-LDL; blue, nuclei stained with TO-PRO-3 iodide (TOPRO). Scale bar, 10 μm. Flow cytometry analysis of DiI-LDL specific binding and uptake in Huh7 cells transfected with NS siRNA or siMMAB and incubated with 30 μg/ml DiI-LDL for 8 h at 37 C (uptake) or 90 min at 4 C (binding) is shown below. Data are mean +/- s.e.m. of three independent experiments. Statistical comparisons by two-sided unpaired Student’s t test. b, c qRT-PCR (b) and Western analysis (c) of SREBP2-responsive genes in Huh7 cells transfected with an NS control siRNA or siMMAB. HSP90 was used as a loading control. Quantification compared to HSP90 is shown in panel (c). Data are mean +/- s.e.m. of three (c) or four (b) independent experiments in duplicate. Statistical comparisons by two-sided unpaired Student’s t test. d Sterol content of Huh7 cells transfected with NS siRNA or siMMAB. Lipids were extracted and analyzed by GC-MS. “Total sterols

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MMAB Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MMAB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  MMAB Protein (NBP1-86602PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (84%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MMAB Antibody - BSA Free

• aquocob(I)alamin vitamin B12s adenosyltransferase
• ATP:cob(I)alamin adenosyltransferase
• ATP:corrinoid adenosyltransferase
• ATR
• cblB
• c-diamide adenosyltransferase, mitochondrial
• cob
• Cob(I)alamin adenosyltransferase
• cob(I)yrinic acid a
• EC 2.5.1.17
• methylmalonic aciduria (cobalamin deficiency) cblB type
• methylmalonic aciduria (cobalamin deficiency) type B
• Methylmalonic aciduria type B protein
• MGC20496

Background

MMAB encodes a protein that catalyzes the final step in the conversion of vitamin B(12) into adenosylcobalamin (AdoCbl), a vitamin B12-containing coenzyme for methylmalonyl-CoA mutase. Mutations in the gene are the cause of vitamin B12-dependent methylmalonic aciduria linked to the cblB complementation group. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MMAB Antibody (NBP1-86602)(1)

Publication using NBP1-86602

• Goedeke L, Canfran-Duque A, Rotllan N Et al. MMAB promotes negative feedback control of cholesterol homeostasis Nature communications 2021-11-08 [PMID: 34750386] (WB, Human)

Bioinformatics

• Gene Symbol: MMAB
• Entrez:
  • 326625(Human)
• Uniprot:
  • Q96EY8(Human)