Annexin A6 Antibody

Western Blot: Annexin A6 Antibody [NBP1-90149] - Analysis in human cell lines SK-MEL-30 and A-431 using anti-ANXA6 antibody. Corresponding ANXA6 RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.

Immunohistochemistry-Paraffin: Annexin A6 Antibody [NBP1-90149] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Western Blot: Annexin A6 Antibody [NBP1-90149] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: Annexin A6 Antibody [NBP1-90149] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: Annexin A6 Antibody [NBP1-90149] - Staining of human pancreas shows strong membranous positivity in islets of Langerhans.

Immunohistochemistry-Paraffin: Annexin A6 Antibody [NBP1-90149] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Annexin A6 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IADTPSGDKTSLETRFMTILCTRSYPHLRRVFQEFIKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVKNKPLFFADKLYKSMKGAGTDEKTLTRIMVSRSEIDLLNIRREFIEKYDKSLHQAIEGDTSGDFLKALLALCGGED
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANXA6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Annexin A6 Protein (NBP1-90149PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22438584)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Annexin A6 Antibody

• 67 kDa calelectrin
• Annexin A6
• annexin VI (p68)
• Annexin VI
• Annexin-6
• ANX6
• ANXA6
• calcium-binding protein p68
• Calelectrin
• calphobindin II
• calphobindin-II
• CBP68
• chromobindin-20
• CPB-II
• CPB-II
• Lipocortin VI
• p68
• p70
• Protein III

Background

The Annexins constitute a family of structurally-related, relatively abundant proteins that exhibit Ca2+-dependent binding to phospholipids. Annexins function in multiple aspects of cell biology including regulation of membrane trafficking, transmembrane channel activity, inhibition of phospholipase A2, inhibition of coagulation and mediation of cell-matrix interactions. Annexin A13 is considered the original progenitor of the 12 members of vertebrate Annexins. The expression of Annexin A13 is highly tissue-specific, being expressed only in intestinal and kidney epithelial cells. This expression is associated with a highly differentiated intracellular transport function. Two alternative splicing isoforms of Annexin A13 exist, both of which bind to rafts.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Annexin A6 Antibody (NBP1-90149)(3)

Publications using NBP1-90149

• Patil SS, Panchal V, Røstbø T et al. RNA-binding is an ancient trait of the Annexin family Frontiers in Cell and Developmental Biology 2023-06-15 [PMID: 37397259] (WB, Rat)
• Bayes A, Collins MO, Croning MD et al. Comparative Study of Human and Mouse Postsynaptic Proteomes Finds High Compositional Conservation and Abundance Differences for Key Synaptic Proteins. PLoS One 2012-01-01 [PMID: 23071613]
• Nakayama H, Fukuda S, Inoue H et al. Cell surface annexins regulate ADAM-mediated ectodomain shedding of proamphiregulin. Mol Biol Cell 2012-05-01 [PMID: 22438584]

Bioinformatics

• Gene Symbol: ANXA6