POLR1A Antibody

Images

 
Immunohistochemistry: POLR1A Antibody [NBP2-32016] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells and glial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

POLR1A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SNYEVIMKSQHLHEVLSRADPKKALHHFRAIKKWQSKHPNTLLRRGAFLSYSQKIQEAVKALKLESENRNGRSPGTQEMLRMWYELDEESRRKYQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POLR1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
POLR1A Protein (NBP2-32016PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for POLR1A Antibody

  • DNA-directed RNA polymerase I subunit RPA1
  • A190
  • polymerase (RNA) I polypeptide A, 194kDa
  • RPA1
  • RPA194
  • RPO14
  • RPO1-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-23017
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NB100-93321
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
H00084172-M10
Species: Hu
Applications: WB, ELISA, ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-159
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP2-30371
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF6696
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-32016
Species: Hu
Applications: IHC, IHC-P

Publications for POLR1A Antibody (NBP2-32016) (0)

There are no publications for POLR1A Antibody (NBP2-32016).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLR1A Antibody (NBP2-32016) (0)

There are no reviews for POLR1A Antibody (NBP2-32016). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for POLR1A Antibody (NBP2-32016) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional POLR1A Products

Bioinformatics Tool for POLR1A Antibody (NBP2-32016)

Discover related pathways, diseases and genes to POLR1A Antibody (NBP2-32016). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLR1A Antibody (NBP2-32016)

Discover more about diseases related to POLR1A Antibody (NBP2-32016).
 

Pathways for POLR1A Antibody (NBP2-32016)

View related products by pathway.

Blogs on POLR1A

There are no specific blogs for POLR1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POLR1A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR1A
Uniprot