Placental Lactogen/CSH1 Antibody


Immunohistochemistry-Paraffin: Placental Lactogen/CSH1 Antibody [NBP2-54710] - Staining of human pituitary gland shows strong cytoplasmic positivity in cells in anterior lobe.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Placental Lactogen/CSH1 Antibody Summary

This antibody was developed against a Recombinant Protein corresponding to amino acids: SHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
Specificity of human Placental Lactogen/CSH1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Placental Lactogen/CSH1 Recombinant Protein Antigen (NBP2-54710PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Placental Lactogen/CSH1 Antibody

  • Choriomammotropin
  • chorionic somatomammotropin hormone 1 (placental lactogen)
  • chorionic somatomammotropin hormone
  • CS-1
  • CSAchorionic somatomammotropin A
  • CSH1
  • CSH2
  • CSMT
  • FLJ75407
  • hCS-A
  • Lactogen
  • PL
  • Placental Lactogen
  • PLchoriomammotropin


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for Placental Lactogen/CSH1 Antibody (NBP2-54710) (0)

There are no publications for Placental Lactogen/CSH1 Antibody (NBP2-54710).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Placental Lactogen/CSH1 Antibody (NBP2-54710) (0)

There are no reviews for Placental Lactogen/CSH1 Antibody (NBP2-54710). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Placental Lactogen/CSH1 Antibody (NBP2-54710) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Placental Lactogen/CSH1 Products

Bioinformatics Tool for Placental Lactogen/CSH1 Antibody (NBP2-54710)

Discover related pathways, diseases and genes to Placental Lactogen/CSH1 Antibody (NBP2-54710). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Placental Lactogen/CSH1 Antibody (NBP2-54710)

Discover more about diseases related to Placental Lactogen/CSH1 Antibody (NBP2-54710).

Pathways for Placental Lactogen/CSH1 Antibody (NBP2-54710)

View related products by pathway.

PTMs for Placental Lactogen/CSH1 Antibody (NBP2-54710)

Learn more about PTMs related to Placental Lactogen/CSH1 Antibody (NBP2-54710).

Blogs on Placental Lactogen/CSH1

There are no specific blogs for Placental Lactogen/CSH1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Placental Lactogen/CSH1 Antibody and receive a gift card or discount.


Gene Symbol CSH1