Placental Lactogen/CSH1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Placental Lactogen/CSH1 Antibody [NBP2-54710] - Staining of human pituitary gland shows strong cytoplasmic positivity in cells in anterior lobe.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Placental Lactogen/CSH1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Placental Lactogen/CSH1 Antibody - BSA Free (NBP2-54710) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids: SHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CSH1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Placental Lactogen/CSH1 Recombinant Protein Antigen (NBP2-54710PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Placental Lactogen/CSH1 Antibody - BSA Free

• Choriomammotropin
• chorionic somatomammotropin hormone 1 (placental lactogen)
• chorionic somatomammotropin hormone
• CS-1
• CSAchorionic somatomammotropin A
• CSH1
• CSH2
• CSMT
• FLJ75407
• hCS-A
• Lactogen
• PL
• Placental Lactogen
• PLchoriomammotropin

Background

Placental lactogen is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CSH1