PIMT Antibody [Allophycocyanin] Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 714-853 of human PIMT (NP_079107.6).
Sequence: RVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLLASFLKADVVFLSPPWGGPDYATAETFDIRTMMSPDGFEIFRLSKKITNNIVYFLPRNADIDQVASLAGPGGQVEIEQNFLNNKLKTITAYFGDLIRRPASET |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
TGS1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
Storage |
Store at 4C in the dark. |
Buffer |
PBS |
Preservative |
0.05% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for PIMT Antibody [Allophycocyanin]
Background
Nuclear receptor coactivators participate in the transcriptional activation of specific genes by nuclear receptors. A new nuclear receptor coactivator-interacting protein, designated PIMT, was identified from a human liver cDNA library by using the coactivator peroxisome proliferator-activated receptor-interacting protein (PRIP) as bait in a yeast 2-hybrid screen. The PIMT cDNA encodes an 852-amino acid protein containing a 9-amino acid methyltransferase motif I (VVDAFCGVG) and an invariant segment (GXXGXXI) found in K-homology motifs of many RNA-binding proteins. Northern blot analysis demonstrated ubiquitous expression of a 3.2-kb PIMT transcript, with highest expression in heart, skeletal muscle, kidney, liver, and placenta. Immunofluorescence studies showed that the PIMT and PRIP proteins are colocalized in the nucleus. PIMT binds 5-adenosyl-L-methionine, the methyl donor for the methyltransfer reaction, and it also binds RNA, suggesting that it is an RNA methyltransferase.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
Species: Av, Bv, Sh
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: WB, ELISA
Publications for PIMT Antibody (NBP3-38476APC) (0)
There are no publications for PIMT Antibody (NBP3-38476APC).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PIMT Antibody (NBP3-38476APC) (0)
There are no reviews for PIMT Antibody (NBP3-38476APC).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PIMT Antibody (NBP3-38476APC) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PIMT Products
Research Areas for PIMT Antibody (NBP3-38476APC)
Find related products by research area.
|
Blogs on PIMT