PCMT1 Antibody

Images

 
Western Blot: PCMT1 Antibody [NBP1-85806] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Mouse Cerebral Cortex tissue
Immunocytochemistry/ Immunofluorescence: PCMT1 Antibody [NBP1-85806] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: PCMT1 Antibody [NBP1-85806] - Staining of human stomach shows cytoplasmic positivity in glandular cells.
Western Blot: PCMT1 Antibody [NBP1-85806] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat ...read more
Western Blot: PCMT1 Antibody [NBP1-85806] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18Lane 2: Human cell line RT-4
Western Blot: PCMT1 Antibody [NBP1-85806] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PCMT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWS
Specificity
Specificity of human, mouse, rat PCMT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCMT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PCMT1 Protein (NBP1-85806PEP)
Publications
Read Publication using NBP1-85806.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24705123)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PCMT1 Antibody

  • EC 2.1.1
  • EC 2.1.1.77
  • L-isoaspartyl protein carboxyl methyltransferase
  • L-isoaspartyl/D-aspartyl methyltransferase
  • PIMT
  • Protein L-isoaspartyl/D-aspartyl methyltransferase
  • Protein-beta-aspartate methyltransferase
  • protein-L-isoaspartate (D-aspartate) O-methyltransferase
  • protein-L-isoaspartate(D-aspartate) O-methyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-92271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-80896
Species: Hu
Applications: IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB393
Species: Hu
Applications: WB, Simple Western, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-67560
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
AF6270
Species: Hu
Applications: ICC
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP

Publications for PCMT1 Antibody (NBP1-85806)(1)

Reviews for PCMT1 Antibody (NBP1-85806) (0)

There are no reviews for PCMT1 Antibody (NBP1-85806). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PCMT1 Antibody (NBP1-85806) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PCMT1 Antibody (NBP1-85806)

Discover related pathways, diseases and genes to PCMT1 Antibody (NBP1-85806). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCMT1 Antibody (NBP1-85806)

Discover more about diseases related to PCMT1 Antibody (NBP1-85806).
 

Pathways for PCMT1 Antibody (NBP1-85806)

View related products by pathway.

PTMs for PCMT1 Antibody (NBP1-85806)

Learn more about PTMs related to PCMT1 Antibody (NBP1-85806).

Blogs on PCMT1

There are no specific blogs for PCMT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCMT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCMT1