NOP58 Antibody

Images

 
Independent Antibodies: Western Blot: NOP58 Antibody [NBP1-81680] - Analysis using Anti-NOP58 antibody NBP1-81680 (A) shows similar pattern to independent antibody NBP1-81681 (B).
Immunocytochemistry/ Immunofluorescence: NOP58 Antibody [NBP1-81680] - Staining of human cell line U-251 MG shows localization to nucleoli fibrillar center. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NOP58 Antibody [NBP1-81680] - Staining of human stomach shows strong nucleolar and moderate nuclear positivity in glandular cells.
Western Blot: NOP58 Antibody [NBP1-81680] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: NOP58 Antibody [NBP1-81680] - Staining of human cerebral cortex shows strong nucleolar and weaker nuclear positivity in neurons.
Immunohistochemistry-Paraffin: NOP58 Antibody [NBP1-81680] - Staining of human kidney shows strong nucleolar positivity in cells in tubules.
Immunohistochemistry-Paraffin: NOP58 Antibody [NBP1-81680] - Staining of human lymph node shows strong nucleolar and moderate nuclear positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: NOP58 Antibody [NBP1-81680] - Staining of human stomach shows strong nucleolar and moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

NOP58 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LDKELNNYIMRCREWYGWHFPELGKIISDNLTYCKCLQKVGDRKNYASAKLSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMAIAPNVTVMVGELVGARLIAHAGSLL
Marker
Nucleolar Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NOP58
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NOP58 Protein (NBP1-81680PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NOP58 Antibody

  • HSPC120
  • NOL5
  • NOP5/NOP58
  • NOP58 ribonucleoprotein homolog (yeast)
  • NOP5nucleolar protein 58
  • Nucleolar protein 5
  • nucleolar protein NOP5/NOP58

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-269
Species: Hu, Mu, Rt, Po, Bv, Ce, Ch, Dr, Eq, Pl, Y, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt, KD
NBP2-36778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-32732
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-57138
Species: Hu
Applications: WB
NBP1-77163
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2595
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-82510
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP1-85156
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13656
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-01764
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20245
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NBP1-82417
Species: Rt
Applications: WB
NBP2-67842
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56326
Species: Hu
Applications: WB, ICC/IF
H00055795-D01P
Species: Hu
Applications: WB, ICC/IF
NBP1-80690
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NOP58 Antibody (NBP1-81680) (0)

There are no publications for NOP58 Antibody (NBP1-81680).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOP58 Antibody (NBP1-81680) (0)

There are no reviews for NOP58 Antibody (NBP1-81680). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NOP58 Antibody (NBP1-81680) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NOP58 Products

Bioinformatics Tool for NOP58 Antibody (NBP1-81680)

Discover related pathways, diseases and genes to NOP58 Antibody (NBP1-81680). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOP58 Antibody (NBP1-81680)

Discover more about diseases related to NOP58 Antibody (NBP1-81680).
 

Pathways for NOP58 Antibody (NBP1-81680)

View related products by pathway.

PTMs for NOP58 Antibody (NBP1-81680)

Learn more about PTMs related to NOP58 Antibody (NBP1-81680).

Blogs on NOP58

There are no specific blogs for NOP58, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NOP58 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NOP58