Phospholipase C like 1 Antibody

Images

 
Immunohistochemistry-Paraffin: Phospholipase C like 1 Antibody [NBP1-80896] - Staining of human lung shows weak to moderate cytoplasmic positivity in pneumocytes and in macrophages.
Immunohistochemistry-Paraffin: Phospholipase C like 1 Antibody [NBP1-80896] - Staining of human cerebellum shows moderate cytoplasmic positivity in purkinje cells.
Immunohistochemistry-Paraffin: Phospholipase C like 1 Antibody [NBP1-80896] - Staining of human heart muscle shows moderate cytoplasmic positivity.
Immunohistochemistry-Paraffin: Phospholipase C like 1 Antibody [NBP1-80896] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Phospholipase C like 1 Antibody [NBP1-80896] - Staining in human kidney and lung tissues . Corresponding PLCL1 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Phospholipase C like 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LRYLVSRSKQPLDFMEGNQNTPRFMWLKTVFEAADVDGNGIMLEDTSVELIKQLNPTLKEAKIRLKFKEIQKSKEKLTTRVTEEEF
Predicted Species
Mouse (98%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLCL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Phospholipase C like 1 Protein (NBP1-80896PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Phospholipase C like 1 Antibody

  • but catalytically inactive protein
  • inactive phospholipase C-like protein 1
  • MGC126580
  • MGC138190
  • phospholipase C, epsilon
  • phospholipase C-deleted in lung carcinoma
  • phospholipase C-like 1
  • phospholipase C-related but catalytically inactive protein
  • PLCE
  • PLCL
  • PLC-L1
  • PRIP

Background

Phospholipase C like 1 is involved in an inositol phospholipid-based intracellular signaling cascade. Shows no PLC activity to phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol. Component in the phospho-dependent endocytosis process of GABA A receptor . Regulates the

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-335
Species: Hu
Applications: IHC, IHC-P, IP, WB
AF5520
Species: Hu, Mu
Applications: WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
NB100-2595
Species: Hu
Applications: IHC, IHC-P, IP, WB
DY393
Species: Hu
Applications: ELISA
AF4538
Species: Hu, Mu, Rt
Applications: WB
AF6270
Species: Hu
Applications: ICC
NBP1-85806
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-24725
Species: Eq, Hu, Pm
Applications: IHC, IHC-P, WB
PP-N4111-00
Species: Hu
Applications: IHC, IP, WB
MAB5285
Species: Hu
Applications: Simple Western, WB
NBP3-09392
Species: Hu, Mu
Applications: WB
NBP1-76729
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
NB100-381
Species: Hu
Applications: ChIP, IP, WB
NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88769
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-80896
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Phospholipase C like 1 Antibody (NBP1-80896) (0)

There are no publications for Phospholipase C like 1 Antibody (NBP1-80896).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Phospholipase C like 1 Antibody (NBP1-80896) (0)

There are no reviews for Phospholipase C like 1 Antibody (NBP1-80896). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Phospholipase C like 1 Antibody (NBP1-80896) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Phospholipase C like 1 Products

Bioinformatics Tool for Phospholipase C like 1 Antibody (NBP1-80896)

Discover related pathways, diseases and genes to Phospholipase C like 1 Antibody (NBP1-80896). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Phospholipase C like 1 Antibody (NBP1-80896)

Discover more about diseases related to Phospholipase C like 1 Antibody (NBP1-80896).
 

Pathways for Phospholipase C like 1 Antibody (NBP1-80896)

View related products by pathway.

Research Areas for Phospholipase C like 1 Antibody (NBP1-80896)

Find related products by research area.

Blogs on Phospholipase C like 1

There are no specific blogs for Phospholipase C like 1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Phospholipase C like 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLCL1
Entrez