PGM1 Antibody (CL3299)

Images

 
Western Blot: PGM1 Antibody (CL3299) [NBP2-61618] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: PGM1 Antibody (CL3299) [NBP2-61618] - Staining of human fallopian tube shows absence of immunoreactivity (negative control).
Immunohistochemistry: PGM1 Antibody (CL3299) [NBP2-61618] - Staining of human skeletal muscle shows moderate cytoplasmic immunoreactivity in muscle fibers.
Immunohistochemistry: PGM1 Antibody (CL3299) [NBP2-61618] - Staining of human liver shows strong positivity in hepatocytes.
Immunohistochemistry: PGM1 Antibody (CL3299) [NBP2-61618] - Staining of human prostate shows moderate cytoplasmic immunoreactivity in smooth muscle.
Immunohistochemistry: PGM1 Antibody (CL3299) [NBP2-61618] - Staining of human colon shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clone
CL3299
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PGM1 Antibody (CL3299) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SILATRKQSVEDILKDHWQKHGRNFFTRYDYEEVEAEGANKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYSD
Epitope
HGRNFFTRYD
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
PGM1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 1 ug/ml
Application Notes
IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
PGM1 Recombinant Protein Antigen (NBP2-61618PEP)

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for PGM1 Antibody (CL3299)

  • EC 5.4.2
  • EC 5.4.2.2
  • Glucose phosphomutase 1
  • GSD14
  • PGM 1
  • phosphoglucomutase 1
  • phosphoglucomutase-1

Background

Phosphoglucomutases (PGM; EC 5.4.2.2) catalyze the transfer of phosphate between the 1 and 6 positions of glucose. Isozymes of PGM are monomeric, with molecular masses of about 60 kD, and are encoded by several genes, including PGM1. In most cell types, PGM1 isozymes predominate, representing about 90% of total PGM activity. One exception is red cells, where PGM2 (MIM 172000) is a major isozyme (Putt et al., 1993 (PubMed 8257433)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89479
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45880
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, WB
DHAPG0
Species: Hu
Applications: ELISA
NB300-917
Species: Hu, Mu
Applications: IF, IHC, IHC-P
NBP1-19015
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC-P, IP, Simple Western, WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
2914-HT
Species: Hu
Applications: BA
AF5075
Species: Hu, Mu, Rt
Applications: WB
NBP1-87311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB500-525
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP2-32601
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89111
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-81923
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-87401
Species: Hu, Mu, Rt, RM
Applications: ICC/IF, IHC, IHC-P, WB
MAB1228
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP
NBP1-69668
Species: Hu
Applications: WB
NBP2-84247
Species: Hu
Applications: WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-03734
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB

Publications for PGM1 Antibody (NBP2-61618) (0)

There are no publications for PGM1 Antibody (NBP2-61618).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGM1 Antibody (NBP2-61618) (0)

There are no reviews for PGM1 Antibody (NBP2-61618). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PGM1 Antibody (NBP2-61618) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PGM1 Products

Bioinformatics Tool for PGM1 Antibody (NBP2-61618)

Discover related pathways, diseases and genes to PGM1 Antibody (NBP2-61618). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGM1 Antibody (NBP2-61618)

Discover more about diseases related to PGM1 Antibody (NBP2-61618).
 

Pathways for PGM1 Antibody (NBP2-61618)

View related products by pathway.

PTMs for PGM1 Antibody (NBP2-61618)

Learn more about PTMs related to PGM1 Antibody (NBP2-61618).
 

Research Areas for PGM1 Antibody (NBP2-61618)

Find related products by research area.

Blogs on PGM1

There are no specific blogs for PGM1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PGM1 Antibody (CL3299) and receive a gift card or discount.

Bioinformatics

Gene Symbol PGM1