GPT Antibody

Images

 
Western Blot: GPT Antibody [NBP1-89111] - Western blot analysis in mouse liver tissue and rat liver tissue.
Immunohistochemistry-Paraffin: GPT Antibody [NBP1-89111] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.
Western Blot: GPT Antibody [NBP1-89111] - Analysis in human liver tissue.
Immunohistochemistry-Paraffin: GPT Antibody [NBP1-89111] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: GPT Antibody [NBP1-89111] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: GPT Antibody [NBP1-89111] - Staining of human colon.
Immunohistochemistry-Paraffin: GPT Antibody [NBP1-89111] - Staining of human kidney.
Immunohistochemistry-Paraffin: GPT Antibody [NBP1-89111] - Staining of human liver using Anti-GPT antibody NBP1-89111.
Immunohistochemistry-Paraffin: GPT Antibody [NBP1-89111] - Staining of human tonsil using Anti-GPT antibody NBP1-89111.
Independent Antibodies: Immunohistochemistry-Paraffin: GPT Antibody [NBP1-89111] - Staining of human colon, kidney, liver and lymph node using Anti-GPT antibody NBP1-89111 (A) shows similar protein distribution ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: GPT Antibody [NBP1-89111] - Analysis in human liver and lymph node tissues using NBP1-89111 antibody. Corresponding GPT RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: GPT Antibody [NBP1-89111] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: GPT Antibody [NBP1-89111] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: GPT Antibody [NBP1-89111] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MASSTGDRSQAVRNGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
GPT Recombinant Protein Antigen (NBP1-89111PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPT Antibody

  • AAT1alanine aminotransferase 1
  • ALT1
  • ALT1EC 2.6.1.2
  • Glutamate pyruvate transaminase 1
  • glutamic-alanine transaminase 1
  • Glutamic--alanine transaminase 1
  • glutamic-pyruvate transaminase (alanine aminotransferase)
  • Glutamic--pyruvic transaminase 1
  • GPT1GPT 1

Background

GPT, also known as Alanine aminotransferase 1, is a 496 amino acid that is 55 kDa, cytoplasm located, most commonly found in liver, kidney, heart, and skeletal muscles; acts as a catalyzer of the reversible transamination between alanine and 2-oxoglutarate to compose pyruvate and glutamate, is involved in cellular nitrogen metabolism, and also in liver gluconeogenesis starting with precursors transported from skeletal muscles. Current research is being performed on several diseases and disorders including vitelliform macular dystrophy, liver disease, epidemic typhus, pyomyositis, kidney cortex necrosis, scrub typhus, hepatitis e, hepatitis c, iron overload hepatitis b, glucose intolerance, biliary atresia, alcohol abuse, cholangitis, cholecystitis, hellp syndrome, viral hepatitis, siderosis, choledocholithiasis, hepatitis a, kawasaki disease, wilson disease, and hepatic encephalopathy. This protein has shown to have interactions with CAPN1, CAPN3, HSPD1, THNSL2, GPT2, AND PSAT1 in pathways such as alanine, aspartate and glutamate metabolism, amino acid synthesis and interconversion (transamination), and metabolism of amino acids and derivatives.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
DPI00
Species: Hu
Applications: ELISA
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DCC270
Species: Hu
Applications: ELISA
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-32263
Species: Hu, Mu
Applications: IHC, IP, WB
NBP1-89134
Species: Hu
Applications: IHC, IHC-P
H00002678-M01
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP2-46395
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-82847
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP2-01506
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-87069
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP2-74045
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB

Publications for GPT Antibody (NBP1-89111) (0)

There are no publications for GPT Antibody (NBP1-89111).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPT Antibody (NBP1-89111) (0)

There are no reviews for GPT Antibody (NBP1-89111). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPT Antibody (NBP1-89111) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPT Products

Bioinformatics Tool for GPT Antibody (NBP1-89111)

Discover related pathways, diseases and genes to GPT Antibody (NBP1-89111). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPT Antibody (NBP1-89111)

Discover more about diseases related to GPT Antibody (NBP1-89111).
 

Pathways for GPT Antibody (NBP1-89111)

View related products by pathway.

PTMs for GPT Antibody (NBP1-89111)

Learn more about PTMs related to GPT Antibody (NBP1-89111).

Blogs on GPT

There are no specific blogs for GPT, but you can read our latest blog posts.
mFlour Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPT
Entrez
Uniprot