PGM2 Antibody


Western Blot: PGM2 Antibody [NBP2-32601] - Analysis in control (vector only transfected HEK293T lysate) and PGM2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: PGM2 Antibody [NBP2-32601] - Immunofluorescent staining of human cell line U-2 OS shows localization to intermediate filaments.
Immunohistochemistry: PGM2 Antibody [NBP2-32601] - Staining of human testis shows strong cytoplasmic staining in a subset of cells in seminiferous ducts.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

PGM2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: PHDKGISQAIEENLEPWPQAWDDSLIDSSPLLHNPSASINNDYFEDLKKYCFHRSVNRETKVKFVH
Specificity of human PGM2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PGM2 Protein (NBP2-32601PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%) Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PGM2 Antibody

  • EC 5.4.2
  • EC
  • EC
  • FLJ10983
  • Glucose phosphomutase 2
  • PGM 2
  • Phosphodeoxyribomutase
  • phosphoglucomutase 2
  • phosphoglucomutase-2
  • Phosphopentomutase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
Species: Hu, Mu
Applications: WB, IB, IHC-Fr, IP
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PGM2 Antibody (NBP2-32601) (0)

There are no publications for PGM2 Antibody (NBP2-32601).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGM2 Antibody (NBP2-32601) (0)

There are no reviews for PGM2 Antibody (NBP2-32601). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PGM2 Antibody (NBP2-32601) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for PGM2 Antibody (NBP2-32601)

Discover related pathways, diseases and genes to PGM2 Antibody (NBP2-32601). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGM2 Antibody (NBP2-32601)

Discover more about diseases related to PGM2 Antibody (NBP2-32601).

Pathways for PGM2 Antibody (NBP2-32601)

View related products by pathway.

PTMs for PGM2 Antibody (NBP2-32601)

Learn more about PTMs related to PGM2 Antibody (NBP2-32601).

Blogs on PGM2

There are no specific blogs for PGM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PGM2 Antibody and receive a gift card or discount.


Gene Symbol PGM2