Adenylate Kinase 1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Adenylate Kinase 1 Antibody [NBP1-87401] - Staining in human fallopian tube and small intestine tissues using anti-AK1 antibody. Corresponding AK1 RNA-seq ...read more
Western Blot: Adenylate Kinase 1 Antibody [NBP1-87401] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Adenylate Kinase 1 Antibody [NBP1-87401] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Adenylate Kinase 1 Antibody [NBP1-87401] - Staining of human small intestine shows low expression as expected.
Western Blot: Adenylate Kinase 1 Antibody [NBP1-87401] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Adenylate Kinase 1 Antibody [NBP1-87401] - Staining of human fallopian tube shows high expression.

Product Details

Summary
Reactivity Hu, Mu, Rt, RMSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Adenylate Kinase 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04 - 0.4 ug/mL
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Adenylate Kinase 1 Protein (NBP1-87401PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-87401 in the following applications:

Reactivity Notes

Rhesus macaque reactivity reported from a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Adenylate Kinase 1 Antibody

  • adenylate kinase 1
  • adenylate kinase isoenzyme 1
  • AK 1
  • ATP-AMP transphosphorylase 1
  • EC 2.7.4
  • EC 2.7.4.3
  • myokinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15291
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP1-33160
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00005236-M01
Species: Bv, Hu
Applications: ELISA, ICC/IF, IP, KD, S-ELISA, WB
NBP2-45880
Species: Hu, Mu, Rt
Applications: IF, IHC, IHC-P, WB
NBP2-66825
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF5075
Species: Hu, Mu, Rt
Applications: WB
NB500-525
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP2-00827
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-19015
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC-P, IP, Simple Western, WB
NBP1-04261
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-66881
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-917
Species: Hu, Mu
Applications: IF, IHC, IHC-P
2914-HT
Species: Hu
Applications: BA
NBP2-32601
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89111
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
8184-CK
Species: Hu
Applications: EnzAct
NBP1-85630
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-81923
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for Adenylate Kinase 1 Antibody (NBP1-87401) (0)

There are no publications for Adenylate Kinase 1 Antibody (NBP1-87401).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Adenylate Kinase 1 Antibody (NBP1-87401) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Rhesus macaque.

Reviews using NBP1-87401:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Rhesus macaque
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Adenylate Kinase 1 NBP1-87401
Enlarge
5
reviewed by:
Addie Luo
WB Rhesus macaque 08/13/2021
View

Summary

ApplicationWestern Blot
Sample TestedAdult lung
SpeciesRhesus macaque
LotA06481

Comments

Comments***Novus Innovators Program - new species or application used on a primary antibody.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Adenylate Kinase 1 Antibody (NBP1-87401) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Adenylate Kinase 1 Products

Bioinformatics Tool for Adenylate Kinase 1 Antibody (NBP1-87401)

Discover related pathways, diseases and genes to Adenylate Kinase 1 Antibody (NBP1-87401). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Adenylate Kinase 1 Antibody (NBP1-87401)

Discover more about diseases related to Adenylate Kinase 1 Antibody (NBP1-87401).
 

Pathways for Adenylate Kinase 1 Antibody (NBP1-87401)

View related products by pathway.

PTMs for Adenylate Kinase 1 Antibody (NBP1-87401)

Learn more about PTMs related to Adenylate Kinase 1 Antibody (NBP1-87401).

Blogs on Adenylate Kinase 1

There are no specific blogs for Adenylate Kinase 1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Addie Luo
08/13/2021
Application: WB
Species: Rhesus macaque

Bioinformatics

Gene Symbol AK1
Entrez
Uniprot