PGC1 alpha Antibody - Azide and BSA Free

Western Blot: PGC1 alpha Antibody [NBP3-08971] - Analysis of extracts of various cell lines, using PGC1 alpha antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 5s.

Immunocytochemistry/Immunofluorescence: PGC1 alpha Antibody [NBP3-08971] - Analysis of U2OS cells using PGC1 alpha Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: PGC1 alpha Antibody [NBP3-08971] - Mouse kidney using PGC1 alpha Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: PGC1 alpha Antibody [NBP3-08971] - Rat lung using PGC1 alpha Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Product Discontinued

PGC1 alpha Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 610-710 of human PGC1 alpha (NP_037393.1). HRTHRNSPLYVRSRSRSPYSRRPRYDSYEEYQHERLKREEYRREYEKRESERAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVFGEIEECTVNL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPARGC1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3) with 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for PGC1 alpha Antibody - Azide and BSA Free

• LEM6
• Ligand effect modulator 6
• ligand effect modulator-6
• L-PGC-1alpha
• peroxisome proliferative activated receptor, gamma, coactivator 1, alpha
• peroxisome proliferator-activated receptor gamma coactivator 1 alpha transcript variant B4-3ext
• peroxisome proliferator-activated receptor gamma coactivator 1 alpha transcript variant B4-8a
• peroxisome proliferator-activated receptor gamma coactivator 1 alpha transcript variant B5-NT
• peroxisome proliferator-activated receptor gamma coactivator 1-alpha
• peroxisome proliferator-activated receptor gamma, coactivator 1 alpha
• PGC1 alpha
• PGC1
• PGC-1(alpha)
• PGC1A
• PGC-1-alpha
• PGC1APGC-1(alpha)
• PGC1peroxisome proliferative activated receptor, gamma, coactivator 1
• PGC-1v
• PPAR gamma coactivator variant form
• PPAR gamma coactivator-1
• PPARgamma coactivator 1alpha
• PPAR-gamma coactivator 1-alpha
• PPARGC1
• PPARGC1A
• PPARGC-1-alpha

Background

Peroxisome proliferator-activated receptor-gamma coactivator 1-alpha (PGC-1alpha), PPAR-gamma coactivator 1-alpha, PPARGC-1-alpha (theoretical molecular weight 91 kDa) belongs to a family of transcription coactivators which includes two other proteins; PGC-1beta and PGC-1-related coactivators. PGC1 alpha interacts with various transcription factors (e.g., FOXO1, PPAR-(alpha, delta and gamma), LXR and FXR), promoting the transactivation of their specific target genes (1). As a transcription coactivator, PGC1 alpha is found in the nucleus where it interacts with transcriptional activators and chromatin modifiers such as p300/CBP and SRC-1 to induce targeted gene expression (1, 2). Transcription factors which interact with PGC1 alpha are involved in several functions related to cellular energy homeostasis including mitochondrial biogenesis, glucose and fatty acid metabolism, and skeletal muscle remodeling. Upstream regulators of PGC1 alpha activity include proteins that play a central role as energy sensors including SIRT1 and AMPK which, through different mechanisms, induce PGC1 alpha activity (3).

PGC1 alpha is highly expressed in skeletal muscle, cardiac muscle, and brown adipose tissue, all tissues with high oxidative capacity (1, 2). PGC1 alpha is also induced by energy taxing physiological states, for example increased physical activity, reduced body temperature, and reduced food intake (3). Because of its role in pathways controlling cellular energy expenditure, PGC1 alpha dysfunction has been associated with pathophysiological conditions such as type 2 diabetes and the metabolic syndrome (3).

References

1.Liang, H., & Ward, W. F. (2006). PGC-1alpha: A key regulator of energy metabolism. American Journal of Physiology - Advances in Physiology Education. https://doi.org/10.1152/advan.00052.2006

2.Arany, Z., He, H., Lin, J., Hoyer, K., Handschin, C., Toka, O., ... Spiegelman, B. M. (2005). Transcriptional coactivator PGC-1alpha controls the energy state and contractile function of cardiac muscle. Cell Metabolism. https://doi.org/10.1016/j.cmet.2005.03.002

3.Canto, C., & Auwerx, J. (2009). PGC-1alpha, SIRT1 and AMPK, an energy sensing network that controls energy expenditure. Current Opinion in Lipidology. https://doi.org/10.1097/MOL.0b013e328328d0a4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for PGC1 alpha Antibody (NBP3-08971). (Showing 1 - 1 of 1 FAQ).

1. Please differentiate to me between PPAR and PGC clearly. I am confused with the difference between these two
   • Thank you very much for contacting Novus Biologicals technical support team and sharing your query on the differences between PGC-1 alpha and PPAR. These are two different proteins encoded by their respective genes and serves different functions. PGC-1 alpha (PGC1A or PPAR gamma coactivator 1-alpha) is a transcriptional co-activator for steroid receptors and nuclear receptors, and it regulates diverse aspects of cellular physiology. It up-regulates the transcriptional activity of PPAR-gamma /thyroid hormone receptor on the uncoupling protein promoter; regulates the key mitochondrial genes involved in adaptive thermogenesis; implicates in the metabolic reprogramming in response to nutrients availability through the coordination of the expression of a wide array of genes involved in the regulation of glucose and fatty acid metabolism. Among our PGC-1 alpha antibodies, NBP1-04676 is our best selling product with nice customer feedback and citations in at least 13 research publications. PPAR (PPAR alpha) on the other hand is a ligand-activated transcription factor which gets activated by the endogenous ligand 1-palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine, and oleylethanolamide (a naturally occurring lipid that regulates satiety), and acts as a key regulator of lipid metabolism. It also acts as a receptor for peroxisome proliferators such as hypolipidemic drugs and fatty acids. It regulates the peroxisomal beta-oxidation pathway of fatty acids, and also functions as transcription activator for the ACOX1 and P450 genes. We have a variety of PPAR alpha antibodies. I hope you will find this information helpful but please let me know if I can support you with anything else from my end. Thank you very much for choosing Novus Biologicals as your quality reagent supplier and we wish you the best with your research projects.

Bioinformatics

• Gene Symbol: PPARGC1A